- +971 50 291 5301
- [email protected]
- Suite 17, The Iridium Building, Umm Suqeim Road
Dubai In December Sunshine, Shopping, and Festive Cheer
Home / Dubai In December Sunshine, Shopping, and Festive Cheer
- November 1, 2023
Discover Dubai in December
December is a magical time to visit Dubai. With its festive atmosphere, pleasant weather, and abundance of activities, the city has something to offer everyone.
In this blog post, we will share everything you need to know to plan a fun and unforgettable trip to Dubai in December. We will cover everything from saving money and avoiding the crowds to experiencing the best of what the city has to offer.
So, get ready to discover the wonders of Dubai in December! Book your trip today and start planning your adventure!
Weather and What to Pack
December is the perfect time to escape the winter chills and experience the pleasant weather of Dubai. With mild temperatures and clear skies, you can enjoy all that this city has to offer without having to worry about the heat.
Average temperatures in Dubai in December range from 16°C (61°F) at night to 26°C (79°F) during the day. Rainfall is rare, but there is a slight chance of light showers.
Pack light layers so that you can adjust to the changing temperatures. Short sleeves and breathable fabrics are ideal for the daytime, while a light sweater or jacket is recommended for the evenings. Be sure to pack sunglasses, sunscreen, a hat, and a reusable water bottle.
If you plan on experiencing Dubai’s vibrant nightlife or enjoying a desert safari, pack comfortable shoes and appropriate clothing. For those indulging in the city’s luxurious dining scene, a smart-casual outfit would be appropriate.
Pack the Essentials
Sunglasses and sunscreen are essential year-round in Dubai, where the sun is strong. A hat and reusable water bottle will also come in handy.
Respect Local Customs
Dubai is a multicultural city, but it is important to respect local customs and dress modestly. When packing, include clothing that covers your shoulders and knees, especially if you plan to visit religious sites or older parts of the city. A scarf can be useful for covering up if needed.
Additional Tips
- Pack a swimsuit and cover-up for the beach or pool.
- If you are planning on visiting any mosques, bring a long scarf or hijab to cover your head.
- If you are short on space, roll your clothes instead of folding them to save space.
- Bring a small backpack or handbag to carry your essentials during the day.
- Leave any valuables at your hotel or Airbnb.
Top Attractions to Visit in Dubai in December
With its dazzling skyline and luxurious lifestyle, Dubai is a city that never fails to captivate visitors. But in December, when the weather is mild and sunny, the town comes alive with a treasure trove of attractions, making it a truly special time to visit.
Dubai Shopping Festival
The Dubai Shopping Festival is one of the city’s biggest and most popular events, and it’s easy to see why. With incredible deals on everything from high-end fashion to traditional souvenirs, there’s something for everyone at this shopper’s paradise. Plus, the festival offers a variety of entertainment and activities to keep visitors entertained, such as concerts, fashion shows, and fireworks displays.
Dubai Miracle Garden
If you’re looking for a feast for the eyes, be sure to visit the Dubai Miracle Garden, a stunning floral wonderland that blooms in full splendor in December. With over 150 million flowers arranged in intricate designs, the garden is a sight to behold.
Dubai Fountain
The Dubai Fountain is another must-see attraction in December. Set against the backdrop of the Burj Khalifa, the world’s tallest building, the fountain puts on a spectacular show of water, music, and light every evening. It’s a truly mesmerizing experience that you won’t want to miss.
Global Village Dubai
If you’re looking to experience the world in one place, be sure to visit Global Village, a cultural festival park that features pavilions from over 70 countries. Here you can sample cuisine from around the world, shop for souvenirs, and enjoy cultural performances.
Burj Khalifa
No visit to Dubai is complete without seeing the Burj Khalifa, the world’s tallest building. Take a ride to the observation deck on the 124th floor for stunning panoramic views of the city and beyond.
Beach Activities
Dubai has some of the most beautiful beaches in the world, and December is a great time to enjoy them. With mild temperatures and clear skies, you can spend your days swimming, sunbathing, and trying out water sports such as jet skiing and parasailing.
Adventure Awaits
For a truly unforgettable experience, embark on a desert safari . Dune bashing across the vast desert in a 4×4 vehicle, go sandboarding and enjoy a traditional barbecue dinner under the stars.
Helicopter Tours
For a truly unforgettable experience, take a helicopter tour over Dubai. Soar above the Palm Jumeirah, the Burj Khalifa, and other architectural marvels, and marvel at the city’s layout from a bird’s-eye view.
Hot Air Balloon Ride
Float peacefully over the Arabian desert on a hot air balloon ride, especially in December’s mild mornings. Watch the sunrise paint the dunes in warm hues and soak up the serene atmosphere. This tour often includes a traditional Bedouin breakfast, making it a truly unique experience.
Dhow Cruise
A Dhow cruise tour is a quintessential Dubai experience. Glide along the Dubai Creek or the Marina in a traditional wooden vessel, often accompanied by a sumptuous dinner and live entertainment. December’s cool evenings provide the perfect ambiance for a romantic or reflective journey along the water.
Embark on a food tour to sample the rich tapestry of flavors that Dubai offers. From traditional Emirati dishes to the explosion of international cuisines, December’s cooler climate is perfect for a culinary exploration of the city’s eateries and street food stalls.
City Tours and Cultural Events
Dubai has a rich history and culture, and there’s no better way to learn about it than by taking a city tour or attending a cultural event. In December, there are a variety of events taking place, such as the Dubai Opera Festival and the Alserkal Avenue Art Festival.
Dubai Accommodation Guide - Where to Stay in Dubai During Winter
Dubai’s diverse accommodation options offer something for every budget and preference, from lavish luxury hotels to budget-friendly hostels. Here are some of the best places to stay in Dubai in December, based on your needs and interests:
A Home Away from Home - Serviced Apartments
Serviced apartments are a great option for travelers who want the flexibility of self-catering accommodation with the added convenience of hotel services such as housekeeping and laundry. Many serviced apartments are located in central areas, making it easy to explore the city’s attractions.
Dubai Luxury Hotels
Dubai is home to some of the world’s most luxurious hotels, offering guests an unforgettable experience. From the iconic Burj Al Arab to the opulent Atlantis, The Palm, these hotels offer everything from stunning views and world-class dining to private beaches and lavish spas.
Dubai Budget Friendly Hotels
Dubai also has a range of budget-friendly accommodation options, such as hostels and guesthouses. These options are ideal for travelers on a tight budget, offering comfortable and affordable accommodation in central locations.
Dubai Al Fahidi Historical District
If you’re looking for an authentic cultural experience, consider staying in the Al Fahidi Historical District. This atmospheric neighborhood is home to traditional Emirati houses, art galleries, and museums. It’s also a great place to sample traditional Emirati cuisine.
Downtown Dubai and Dubai Marina
Downtown Dubai and Dubai Marina are two of Dubai’s most popular tourist destinations. These areas are home to some of the city’s most iconic landmarks, such as the Burj Khalifa, the Dubai Mall, and the Dubai Fountain. They also offer a wide range of hotels, restaurants, and shops.
Family-Friendly Stays - Beach Resorts
Dubai’s many beach resorts are perfect for families. These resorts offer a variety of activities and amenities for children of all ages, such as swimming pools, kids’ clubs, and playgrounds. Many also have direct access to the beach, making it easy for families to enjoy the sand and sea.
Tips for Choosing Your December Den
When choosing accommodation in Dubai in December, there are a few things to keep in mind:
- Book early: December is a popular time to visit Dubai, so it’s important to book your accommodation well in advance, especially if you’re staying at a popular hotel or resort.
- Consider your budget: Dubai has a wide range of accommodation options to suit all budgets. Be sure to set a budget before you start booking so that you don’t overspend.
- Think about your location: Dubai is a large city, so it’s important to consider where you want to stay. If you’re planning on doing a lot of sightseeing, it’s best to stay in a central location. If you’re looking for a more relaxing experience, you may want to stay in a beach resort or other outlying area.
- Read reviews: Before you book your accommodation, be sure to read reviews from other guests. This can help you get a better idea of what to expect and avoid any potential surprises.
With its diverse accommodation options and mild December weather, Dubai is the perfect place to enjoy a winter vacation. By following these tips, you can choose the best place to stay for your needs and budget.
Local Cuisine and Where to Eat in Dubai
Savoring the flavors of dubai.
Dubai is a melting pot of cultures, and its cuisine reflects this diversity. From traditional Emirati dishes to international fare, there’s something to tantalize every taste bud in Dubai.
The Essence of Emirati Cuisine
Emirati cuisine is influenced by the country’s Arabian heritage and Bedouin traditions. Popular dishes include machboos (spiced rice with meat or fish), harees (wheat porridge with meat), and salona (a meat and vegetable stew). Emiratis also enjoy a variety of sweets, such as baklava, luqaimat (fried dough dumplings), and chebab (pancakes).
Fine Dining: A Symphony of Flavors
Dubai is also home to a world-class fine dining scene. Michelin-starred restaurants offer innovative and creative dishes that showcase the city’s diverse culinary landscape. From modern Emirati cuisine to international fusion fare, there’s a fine dining restaurant in Dubai to suit every taste and budget.
Street Food: A Taste of Authenticity
For a more authentic dining experience, head to one of Dubai’s many street food stalls. These stalls offer a variety of delicious and affordable dishes, such as shawarma (grilled meat), falafel (fried chickpea fritters), and manakish (flatbread with toppings). Street food is a great way to sample the local cuisine and experience the city’s vibrant culture.
Beachside Dining: Alfresco Bliss
Dubai’s many beachside restaurants offer stunning views and a relaxed atmosphere. Enjoy a leisurely meal while watching the sunset over the Arabian Gulf. Beachside restaurants serve a variety of cuisines, from Emirati to international, so there’s something for everyone.
Global Village: A World of Flavors
Global Village is a multicultural festival park that features pavilions from over 70 countries. This is the perfect place to sample cuisines from all over the world without having to leave Dubai. From Indian curries to Chinese dumplings to Mexican tacos, there’s something to satisfy every craving at Global Village.
Family-friendly Eateries: Joyful Meals for All Ages
Dubai has a variety of family-friendly eateries that offer delicious food and fun activities for kids of all ages. From restaurants with play areas to buffets with a wide range of options, there’s a family-friendly eatery in Dubai to suit every need.
Finding Halal Options
Dubai is a Muslim-majority city, so halal food options are readily available. Most restaurants in Dubai offer halal dishes, and there are also many dedicated halal restaurants. You can easily find halal options at all price points, from street food stalls to fine dining restaurants.
No matter what your budget or taste preferences, you’re sure to find a delicious meal in Dubai. With its diverse cuisine and vibrant dining scene, Dubai is a foodie’s paradise.
Navigating the City of Gold
Effortless transits: dubai's public transportation.
Dubai has a comprehensive and efficient public transportation system that makes it easy to get around the city. The Dubai Metro is a popular option, with two lines that cover most of the city’s major attractions. Buses are also a convenient and affordable way to travel, and there are dedicated bus lanes on major roads to help keep traffic flowing.
Taxis and Ride-Hailing Apps: Personalized Journeys
Taxis and ride-hailing apps are also popular ways to get around Dubai. Taxis are readily available, and ride-hailing apps such as Careem and Uber offer convenient and affordable on-demand transportation.
Renting a Car: Freedom on Four Wheels
If you prefer the flexibility of renting a car, there are many car rental companies in Dubai. However, keep in mind that traffic can be heavy, especially during peak hours.
Water Taxis and Abras: A Charming Glide
Water taxis and abras are traditional wooden boats that offer a unique way to get around Dubai Creek and the Dubai Marina. This is a great way to see the city from a different perspective and experience its traditional culture.
Cycling Paths: Eco-friendly Exploration
Dubai has a growing network of cycling paths, making it a great way to explore the city in a sustainable and eco-friendly way. There are dedicated cycling paths in many popular areas, such as the Dubai Marina and the Palm Jumeirah.
Walking: A Pleasant Stroll
Dubai is also a very walkable city, especially in the cooler winter months. Many of the city’s major attractions are within walking distance of each other, and there are many pedestrian-friendly areas, such as the Dubai Marina Walk and Downtown Dubai.
Accessibility: Ease of Movement
Dubai is committed to providing accessible transportation for all. The Dubai Metro and buses are equipped with ramps and lifts, and there are many accessible taxis and ride-hailing vehicles available.
Getting around Dubai is easy and convenient, with a variety of transportation options to choose from. Whether you prefer public transportation, taxis, ride-hailing apps, renting a car, or exploring on foot or by bicycle, you’re sure to find the perfect way to navigate the City of Gold.
Here are some additional tips for getting around Dubai:
- If you’re using public transportation, be sure to purchase a Nol card . This rechargeable card can be used on the Dubai Metro, buses, and water taxis.
- If you’re taking a taxi, make sure the meter is running before you start your journey.
- If you’re using a ride-hailing app, be sure to check the fare estimate before you book your ride.
- If you’re renting a car, be sure to familiarize yourself with the local traffic laws.
- If you’re walking, be aware of the hot weather and dress appropriately.
- If you have any accessibility needs, be sure to contact the transportation company in advance to make arrangements.
Tips and Tricks for a Smooth Trip to Dubai
Planning ahead.
Booking your accommodations and top attractions in advance, especially if you’re traveling during peak season, is key to securing the best deals and avoiding disappointment. Dubai offers a wide range of accommodation options, from budget-friendly guesthouses to luxurious hotels. When choosing your accommodation, consider your budget, location preferences, and amenities.
Dos and Don'ts
Dubai is a multicultural city with a rich heritage. It’s important to dress modestly and respect local customs. Here are a few dos and don’ts:
- Do dress modestly when visiting public places, such as mosques and government buildings.
- Do greet people with a handshake or a nod.
- Do avoid public displays of affection.
- Do not consume alcohol in public.
- Do not take photographs of people without their permission.
Connectivity
Purchasing a local SIM card is a convenient way to stay in touch with friends and family back home. You can also use free Wi-Fi at most hotels, restaurants, and cafes.
Money Matters
Credit cards are widely accepted in Dubai, but it’s always a good idea to have some cash on hand for smaller purchases. The official currency of Dubai is the UAE dirham (AED).
Language Barriers
English is widely spoken in Dubai, so you’re unlikely to encounter any major language barriers. However, it’s always appreciated if you can learn a few basic Arabic phrases.
Health and Safety
Dubai is a safe city, but it’s always important to be aware of your surroundings and take precautions against petty theft. Tap water in Dubai is safe to drink, but many people prefer to drink bottled water.
App Assistance
There are a number of travel apps that can be useful when visiting Dubai. These apps can help you with everything from finding your way around to booking tours and activities.
Beating the Crowds
Dubai is a popular tourist destination, so it’s important to choose your travel times carefully to avoid the crowds. The cooler winter months are the ideal time to visit Dubai, as the weather is mild and pleasant. If you’re visiting during the summer months, be sure to plan your activities for the early morning or evening hours to avoid the heat.
Fast-track tickets are also a great way to avoid the crowds at popular attractions.
Savor the Season
Dubai’s pleasant winter weather makes it the perfect time to enjoy outdoor activities. From beach days to desert safaris, there’s something for everyone to enjoy.
Here are a few additional tips:
- Pack sunscreen, sunglasses, and a hat to protect yourself from the sun.
- Wear comfortable shoes, as you’ll likely be doing a lot of walking.
- Stay hydrated, especially if you’re spending time outdoors.
- Be aware of the cultural differences and respect local customs.
- Have fun and enjoy your time in Dubai!
Embracing the Winter Wonders of Dubai
As we conclude our comprehensive guide to visiting Dubai in December, we reflect on a city that transforms into a winter wonderland, albeit with its unique desert twist. This is a time when the city not only opens its arms to cooler breezes, but also to travelers from all corners of the globe, offering a blend of traditional charm and contemporary splendor.
Dubai in December is an experience like no other. The streets are aglow with festive lights, the aroma of exotic spices fills the air in souks, and the sound of waves gently crashing on pristine beaches provides a serene soundtrack to a perfect winter holiday. From the architectural prowess displayed by the towering Burj Khalifa to the cultural heartbeat echoing through the alleys of Al Fahidi Historical Neighborhood, each facet of Dubai offers a story, a new adventure, a memory to cherish.
Whether you’re bargaining in the bustling markets, savoring the flavors of sumptuous Emirati cuisine, exploring the vastness of the desert, or simply soaking in the sun by the Arabian Gulf, December is a month that brings out the very best in Dubai. The city is not just a place to visit, but a world to experience, a destination that caters to every age, every interest, and every desire.
We hope that this guide serves not only as a roadmap to your December travels, but also as an inspiration to explore the depths and heights of this vibrant city. As the year winds down, let Dubai be the highlight, the grand finale, or the fresh start to new beginnings.
Dubai awaits you with open skies and endless possibilities. Welcome to a December to remember.
The Desert Safari Posts
4×4 Upgrades for Dune Bashing in Dubai
How to Renew a Tour Guide License in Dubai
How to Become a Tour Guide in Dubai
How to Book Desert Safari in Dubai
How to Apply for a Desert Safari License in Dubai
How to Drive a Dune Buggy in the Dubai Desert
How to Drive an Automatic ATV Safely in the Dubai Desert
How to Ride a Camel in Dubai – A Comprehensive Beginner’s Guide
The Ultimate Guide to Visiting Dubai in June
Discover Dubai in May
Explore the Best Camping Spots Near Dubai
How Much is Dune Buggy in Dubai
Exploring the Great Outdoors Top 11 Must-Visit Places in the UAE for 2024
Discover Dubai: The Ultimate Stopover Guide for Every Traveler
Exploring the Cool Mystery – How Dubai’s Desert Stays Cooler Than the City
16 Picture-Perfect Moments from Desert Safari Dubai: Captions, Laughs, and Unforgettable Memories
Eid al-Fitr 2024 A Magical Evening Desert Safari in Dubai
Dubai In April A Comprehensive Traveler’s Guide
Dubai in Ramadan Where Culture, Luxury, and Faith Collide
Dubai In March When the Desert Blooms and You Won’t Melt
Best Places To Celebrate Valentine’s Day in Dubai
Myths About Dubai Desert Safari
Evening Vs Overnight Desert Safaris Dubai
The Ultimate Guide to Visiting Dubai in February Weather, Events, & More
VIP vs Premium Desert Safari Tours in Dubai A Detailed Comparison
- Terms & Conditions
- Privacy Policy
- Evening Desert Safari Tours
- Morning Desert Safari Tours
- Desert Dune Buggy Tours
- Overnight Desert Safari
- Desert Safari Sharjah
- Abu Dhabi Desert Safari Tours
- Desert Safari Combo Packages
- Desert Safari Group Bookings
- Private Desert Camp in Dubai
- Evening Safari Tours Comparison
- Special Events in Dubai Desert
- Desert Safari Gallery
The Desert Safari 2012 © 2024. All Rights Reserved – Suite 17, The Iridium Building, Umm Suqeim Road
20 Magical Things To Do In Dubai This December
You’ll never run out of things to do this December in Dubai with our handy guide to exhibitions, Christmas markets, lights festivals and free fireworks.
Not just once upon a December. Every single December in Dubai is one to remember with a glut of activities, events, concerts and jolly good festive activities that truly make this the most wonderful time of the year. From Christmas Markets and dazzling drone shows to daily fireworks and some of the most scintillating NYE parties and cinema pop-ups, there are tons of things to do in Dubai this December .
1-6. Visit these splendid Christmas Markets in Dubai
December is when it begins to look a lot like Christmas in Dubai. Each year, the city goes all out to bring us some of the dreamiest Christmas Markets and winter wonderlands that can give Austrian and German traditional festive markets stiff competition. Of course, we do it with typical Dubai bling and superlatives and a dash of Arabian Night vibes, with 52-foot-tall Christmas trees , Santa Claus riding in on Abra boats, turkey and cranberry shawarmas and more. Find the full list of Christmas markets here .
7. Gaze at mesmerising drone shows every night
8. Grab a Cardigan and warm up in the glow of this Taylor Swift Candlelight concert
9. End 2023 on a sweet note at the Hatta Honey Festival
Hatta, the beloved mountain town on the outskirts of Dubai is hosting the annual Hatta Honey Festival from December 27 to 31 . Beekeepers from across the UAE will buzz in and offer visitors the chance to learn more about beekeeping, types of honey, and the elements that impart distinct flavours to the natural sweetener. Find more info here .
10. Step into ancient Egypt at this immersive show about Queen Hatshepsut
11. Walk through stunning light installations
The annual Dubai Lights festival is running until January 14 . Gleaming light installations created by talented artists, designers, architects and studios from around the world dot specific destinations in Dubai and feature different themes. Don’t miss neon light decorations at Al Seef , Gold Souk , D3 and Palm West Beach . The Dubai Creek Abras will be strung with glowing lights and it’s your chance to pictures with giant inflatable Anooki cartoon sculptures that have been travelling the world. Find details here.
12. Attend a bangin’ good concert by EDM artist Nucleya
Award-winning Indian electronic music producer Nucleya is bringing the party to Zero Gravity on December 23 as part of the Winter Music Fest l ine-up. Known for his eclectic blend of EDM beats set to trippy visual displays, expect to bounce to killer beats of tracks like Bass Rani , Let’s Nacho, B akar Bakar and Kaana . It’s time to wave your arms in the air and leave all cares behind. Tickets from AED 150 are available here
13. Travel to Japan at the new Salt pop-up camp
Homegrown burger joint Salt’s annual winter pop-up camp is one Dubai residents eagerly look forward to. This year, the viral pink outdoor camp outside the Museum of the Future has adopted a Japanese theme with vibrant matcha green decor, scrummy Japanese cuisine , entertainment by live samurai dancers , calligraphy artists on-site creating special souvenirs and more. You’ll still get to see the iconic airstream trailer, campfire tents and camel’s traipsing around DIFC. Find more details here .
14. Enjoy a free alfresco movie night under the stars
JLT Park ’s annual Cinema Under the Stars screenings are back for the winter season, transforming the green space in the middle of JLT’s concrete jungle into a vibrant movie theatre. The free showings include an exciting line-up of holiday classics, family-friendly animated flicks and more. Find details here .
15. Watch free fireworks daily for a month
DSF is a wellspring of delight that never runs dry – after drone shows and light displays, you can look forward to spectacular fireworks every day until January 14 . Get the full list of locations and timings of these pyrotechnic shows here.
16. Rock out to a Chris Brown concert
View this post on Instagram A post shared by BROWN (@chrisbrownofficial)
R&B crooner Chris Brown is taking to Coca-Cola Arena on December 22 for a special performance. The Grammy Award-winning artist will belt out all-time hits like Forever , Yeah 3x , and tracks from his new album called 11:11 . Jamaican-American rapper Sean Kingston ( Fire Burning, Beautiful Girls ) and Emirati rapper EZOW ( BANDZ ) will be joining him at this gig so it’s going to be an evening of chart-topping music you can dance the night away to. Get tickets here.
17. Get busy at rappers Sean Paul and T.I.’s concert
View this post on Instagram A post shared by Dubai Calendar (@dubai_calendar)
On December 30 , it’ll be cold outside but the Temperature will rise inside Coca-Cola Arena as Jamaican rapper and singer Sean Paul performs with American rapper T.I. The music heavyweights spit rhymes and create an electrifying ambience ahead of NYE with singles like Buggati , Get Busy , Temperature and more. Get tickets here .
18. Head over to the Speed Music Fest featuring Jonita Gandhi and Ali Zafar
Desi music fans should catch Bollywood singer Jonita Gandhi and Pakistani singer-actor Ali Zafar on December 23 at the Speed Music Fest in Coca-Cola Arena . Groove the night away to hits like The Breakup Song, Sun Re Sjaniya . Mariyam Kisat – Dubai-based RJ and winner of the Voice Of UAE competition will be opening for these renowned musicians. Get tickets here
19. Feed your soul at The Spot’s Soul Brunch
20. Drop by the new Cinema Akil pop-up at 25Hours Hotel
Cinema Akil , the only independent arthouse cinema in the GCC has a temporary seasonal branch set up in place at 25Hours Hotel in One Central. Cinephiles no longer have to schlep out to Al Quoz for their dose of celluloid culture. The open-plan theatre created inside a pavilion will be open until May 2024 open daily from 12pm to 1pm with free screenings four times a week. Christmas weekend is your chance to watch Home Alone with screenings on December 24, 28 and 31 . Find more details here .
TYPE IN YOUR SEARCH AND PRESS ENTER
You will be redirected to your dashboard shortly. We will also call you back in 24 hrs .
- Dubai In December 2024: 3 Splendid Reasons For Taking A Trip To The UAE
27 Dec 2021
Dubai is possibly one of the most popular and desired holiday destinations for thousands of people around the world. From the world’s tallest building to the second largest shopping mall, this city has it all. It is the place where rich people around the world come to spend their holidays in luxury and extravaganza. Dubai is a city that has transformed itself from a small fishing village to an indulgent and glamorous cosmopolitan city in less than 50 years time. The Burj Khalifa, Dubai Shopping Mall, Desert Safari, Palm Island and so many more beautiful landmarks in Dubai, attract millions of tourists every year.
On top of that, Dubai experiences hot and sunny weather throughout the year-round. Even during the winter months, it is hot and sultry. That is why a lot of tourists from the Northern Hemisphere travel to this Arab country during the months of December and January. December is the ideal time to visit Dubai and experience some brilliant fun activities and man-made wonders. In today’s blog, we will discuss a trip to Dubai in December and a lot more.
Dubai Weather In December
Image Source Dubai is mostly sunny and hot for all the months of the year and that is because of the dry desert climate. In spite of the onset of the cold season in December, the temperatures in this city do not fluctuate too much from its origins. Usually, the temperatures fall to a minimum of 15°C to 16°C at night once the sun sets and during the daytime, it reaches 26°C to 30° as well. The tropical climate of Dubai makes it a paradise for those who love summers and want to enjoy various water sports.
The sun is out for at least 8-10 hours during the day and the seawater scales a temperature of around 24°C for most times of the year. The humidity is low and that is why we suggest you carry a water bottle at all times. Once the evening falls, the atmosphere becomes much more soothing and that is why you will be able to explore the city much better than in the day.
3 Reasons Why December Is The Best Time
You will get a lot of different reasons to travel to Dubai. But we believe there are three primary reasons why this city is flocked by tourists during this month of the year. Here are the three very important reasons why you should be visiting Dubai in December.
1. Perfect Weather
Image Source December is the perfect time to visit Dubai because of the soothing tropical weather. If you are experiencing feeling cold weather is in your hometown, then Dubai can be the perfect getaway where you can experience the warm sun and indulge in posh activities. The scorching heat is gone, yet it is still warm. Some of them include desert safaris and sailing.
Skydiving In Dubai: An Ultimate Guide For The Adrenaline Junkies To Take That Dive In The Sky!
2. Holiday Festivities
Image Source Dubai is gorgeously lit with fairy lights and mesmerising fireworks on many days of the December calendar especially on 25th and 31st of this month. Don’t forget to miss out on the light and sound show at the Burj Khalifa during both these days. There are several lively parties, street festivals, events and several other live entertainments organized during this time. This allows you to experience a blend of both modern and traditional style of celebration.
26 Free Things To Do In Dubai And Experience Over The Top Luxury Without Spending A Penny In 2022
3. December Special
Image Source There are some events which take place only during this one month of the year. Some of them are Dubai International Film Festival, Dubai Shopping Festival and the UAE National Day Festival. Other special activities in which you can participate include hot air balloon ride, camel ride, deep-sea diving and skydiving. The perfect weather in December allows the tourists to do all these without any worries.
Top 32 Romantic Restaurants In Dubai In 2022: Dine Like The Royals!
5 Best Things To Do In Dubai In December
When you are in Dubai there is no dearth of activities that you can carry out in this Arab city. There are plenty of recreational facilities that will keep you busy throughout the day. In this segment, take a look at the best things which you can do in Dubai in December.
1. Visit Burj Khalifa
Image Source If you are in Dubai, then you will be able to witness the Burj Khalifa from every corner of the city. This 825 metres high man-made engineering marvel provides a beautiful panoramic view of the entire city. Don’t forget to visit the Burj on 31st night to give your eyes a spectacular treat of the grand light and sound show. Nothing can be a more perfect way to start your new year than this with your family.
10 Most Fabulous Places To Enjoy Desert Camping In Dubai In 2022
2. Enjoy The La Perle Show
Image Source Designed and created by legendary Franco Dragone, the La Perle Show is visually spell-bounding and provides a mesmerising experience to the spectators. The theatre is uniquely designed and features more than 60+ world-class performers who perform amazing stunts and extraordinary feats during the show. This is a must-visit place if you are travelling to Dubai with your children.
60 Tourist Places In Dubai: Do Not Come Back Without Visiting These Marvels In 2022
3. Hop On A Dhow Cruise
Image Source The Dhow Cruise is a brilliant way to explore the cityscape. The cruise sails along the Dubai Creek in authentic wooden Arab Dhow that embraces the traditional Bedouin charm. The cruise lasts for 2 hours and their food spread is also delicious and tasty.
19 Best Things To Do In Dubai For A Perfect Vacation In 2022!
4. Skydiving
Image Source For all those adventure junkies, skydiving in Dubai is one of the musts to do activities among all the others. Dive into the air from a height of almost 14,000 feet and come sailing down towards the ground before being pulled away by the parachute. You can choose different packages of skydiving and also include it beforehand in your cheap holidays to Dubai in December package for affordable rates.
12 Dubai Travel Tips To Help You Make The Most Of Your Perfect Holiday In 2022
5. Enjoy A Desert Safari
Image Source Desert safari in Dubai is one of the best things to do in Dubai in December. You can visit the vast expanse of the Arabian Desert and participate in different desert activities like sand bashing, sandboarding, quad bikes and the much-desired camel ride. Also, stay overnight at one of the Bedouin tents and enjoy your time listening to traditional songs, witnessing belly dance, and eating local cuisine.
20 Best Things To Buy In Dubai In 2022 That Excite The Shopaholic In You
What To Wear In Dubai In December
Image Source As we already mentioned, Dubai experiences hot and sultry weather for the most part of the year. That is why we recommend tourists to pack lightly for the month of December as well. You can pack half sleeve t-shirts, shorts, cotton shirts, and sandals in order to explore more comfortably. However, you need to keep in mind that Dubai has some restrictions on dress code. You cannot wear bikinis and undercut crops. That is why it is essential that you carry long dresses, tops, shirts, t-shirts, pants, hoodies, sweaters, and jeans.
For women, you need to make sure that your clothes are not too tight, are see-through and do not reveal too much of your skin to the outside. Make sure to pack your sunscreen, sunglasses and hats to keep the direct sun rays off your skin.
12 Hair-Raising Water Sports In Dubai For A Vacation Of A Lifetime In 2022
These are the best things to do in Dubai in December which you cannot simply miss out on. It is an excellent time to be in Dubai. The glistening desert and sky full of sunshine looks pleasant in this climate. Enjoy sightseeing on your vacation plan a wonderful vacation in Dubai .
Disclaimer: TravelTriangle claims no credit for images featured on our blog site unless otherwise noted. All visual content is copyrighted to its respectful owners. We try to link back to original sources whenever possible. If you own the rights to any of the images, and do not wish them to appear on TravelTriangle, please contact us and they will be promptly removed. We believe in providing proper attribution to the original author, artist or photographer.
Please Note: Any information published by TravelTriangle in any form of content is not intended to be a substitute for any kind of medical advice, and one must not take any action before consulting a professional medical expert of their own choice.
Frequently Asked Questions About Dubai In December
Is December a good time to visit Dubai?
Yes. December is one of the best months of the year when you can visit Dubai. The temperature is hot and warm but not scorching like it is during the summer months. Also, there are various festivals and events that are held during this time of the year.
Is it cold in Dubai in December?
No. The average temperature in Dubai during the weeks of December are between 24°C to 30°C. Hence, Dubai experiences a dry and hot climate even in the month of December.
How hot is Dubai in December?
The temperatures in Dubai in December are hot. But it is not similar to the temperatures that are prevalent during the summer months. The minimum average temperature is 24°C and the maximum is around 30°C in most regions.
Can you swim in December in Dubai?
Yes. You can surely swim and take part in different water activities in Dubai this month. The water temperature is about 23°C, making it really comfortable and perfect for it.
Recent Posts
Dubai To Salalah Road Trip Guide With Top 5 Stops To Explore
Beach Clubs In Dubai For A Luxuriously Relaxing Vacation
Discover 8 Mesmerising Hidden Gems In Dubai Waiting For You To Explore
Interesting Facts About Burj Khalifa That Unveil Its Secrets
Step Into Opulence At The Dubai Festival City Mall
2024 में 15 दुबई में न करने लायक चीज़ें नहीं तो आप अपनी छुट्टी पर गहरी मुसीबत में फंस जाएंगे
Trending Blogs
20 Mysterious Places In India To Visit In 2024 More Bizarre Than The Bermuda Triangle
10 Scariest Roads In India That Are A Driver’s Nightmare
101 Places To Visit In India Before You Turn 30 in 2024
35 Exotic Places To Visit In December In India 2024 To Enjoy A Surreal Vacation
60 Best Honeymoon Destinations In India In 2024
95 Best Honeymoon Destinations In The World In 2023 For A Romantic Escape!
Best Places To Visit In India By Month
Best places to visit outside india by month.
- TravelTriangle
- International
- Dubai »
- Tour Packages
- Honeymoon Packages
- Family Packages
- Budget Tour Packages
- Luxury Tour Packages
- Adventure Tour Packages
- Group Tour Packages
- Maldives Tour Packages
- Bali Tour Packages
- Dubai Tour Packages
- Singapore Tour Packages
- Thailand Tour Packages
- Europe Tour Packages
- Sri Lanka Tour Packages
- Tour Packages From Delhi
- Tour Packages From Mumbai
- Tour Packages From Bangalore
- Tour Packages From Chennai
- Tour Packages From Kolkata
- Tour Packages From Hyderabad
- Tour Packages From Ahmedabad
- Thailand Tourism
- Bali Tourism
- Singapore Tourism
- Maldives Tourism
- Mauritius Tourism
- Dubai Tourism
- Europe Tourism
- Hotels in Thailand
- Hotels in Maldives
- Hotels in Mauritius
- Hotels in Bali
- Hotels in Dubai
- Hotels in Singapore
- Hotels in Sri Lanka
Visiting Dubai in December – The definitive guide
Things to do in Dubai Dubai Travel Guide Best Time to Visit Dubai Dubai in December
Dubai is a city that takes possibility and converts them into brilliance. The possibility of a man-made island? Dubai has the largest, Palm Jumeirah ; A skyscraper? The world's tallest building, Burj Khalifa ; Snow in desert? Ski Dubai ; Non-stop shopping? The world's second largest mall, Dubai Mall ; A holiday? From breathtaking views to luxury stays, desert safaris to beaches, indoor-outdoor adventures to unmatched shopping, Dubai offer oodles to make your holiday the best one yet. While the city is welcoming throughout the year, December offers a comparatively cooler weather and is bustling with activities and festivities, making it the best times to visit.
Quick jumplinks to navigate the guide
Why is Dubai in December a must-visit?
Dubai weather in december.
- Dubai in December: things to do
- Dubai in December: events to look out for
- Dubai in December: 5-day itinerary
- Dubai essentials
Tips for visiting Dubai in December
- The perfect weather : With just two kinds of weather on the menu, hot and hotter; to avoid scorching summer sun, ‘winter months' especially December, is one of the best times to visit the city. Additionally, it lets you step out of your snowy winter snugs to soak in some desert sun amidst the holiday festivities.
- Holiday festivities : Dubai goes all out for festivities, from the world-famous fireworks display to brightly lit streets to huge and mesmerizing Christmas trees; from lively parties to live entertainments that offer a blend of both traditional and modern cultural traditions.
- December special : While Dubai is never short of things to explore, from desert safaris to hot air balloon ride to dune bashing to water sports, December rings in a bunch of specially curated events such as Sole DXB, Dubai Shopping Festival, UAE National Day Festival to name a few.
December is the most suitable time to visit Dubai - with temperatures ranging from 26°C to 14°C, there's no better time to be out and about in the city! Visit Dubai in winter to take advantage of the fantastic weather, incredible shopping discounts and festive vibes.
Dubai in December : Things to do
Burj khalifa.
Experience the 825 m high engineering marvel up close and step on its observatory deck to breathe in the panoramic view of Dubai. While the world's tallest building is awe-inspiring throughout the year, imagine the largest light and sound show on a single structure to start your New Year with.
December Timings, At The Top Daily, 8 AM - 12 AM
1 Sheikh Mohammed bin Rashid Blvd, Dubai United Arab Emirates Getting There ›
Created by the legendary Franco Dragone , the visually captivating show runs below, on, and above the stage. This uniquely designed theater features 65 world-class performers who fly through the theater, make a 25m high dive into the onstage pool with over 2 million liters of water.
December Timings Shows start at 6:30 PM and 9 PM
260 Sheikh Zayed Road, Dubai United Arab Emirates Getting There ›
Garden Glow
The unique Garden Glow recreational park picks a different theme each season and involves over 500 artists to builds installations that are stunning during the day and glow as the night falls. Made from tons of biodegradable stuff and millions of energy-efficient LED lights, it's kid-friendly and environment-friendly.
December Timings Sunday - Friday: 5 PM - 11 PM; Saturday & national holidays: 5 PM - Midnight Season 9 started on September 15, 2023.
Zabeel Park, Gate No - 6 & 7 Area - B, Dubai United Arab Emirates Getting There ›
Dinner in the Sky
Who says you cannot have an adventure while feasting on a gourmet meal. Dinner in the Sky serves delectable food while you are suspended 50 meters above the ground. Skyscrapers like Atlantis, Burj Al Arab, and Burj Khalifa give you company while you relish a 360° view of the Dubai Marina.
December Timings Daily, 2 PM – 11 PM
Skydive, Al Seyahi St., Dubai United Arab Emirates Getting There ›
Dubai's very own beach district, La Mer offers breathtaking views, family-friendly activities, palm-tree lined boulevards, and an impeccable shopping and dining experience. La Mer is one of the best place to ring in the New Year's, with great vantage points for the laser shows and fireworks display.
December Timings Sunday - Thursday: 10 AM - 10 PM; Friday & Saturday: 10 AM to Midnight
Jumeirah Street, Dubai United Arab Emirates Getting There ›
Dhow Cruise
Cruise along the Dubai Creek in an authentic wooden Dhow to embrace the city's true essence as 21st-century marvels harmonize with traditional Bedouin charm. The views during the two-hour cruise are considerably enhanced during December as the city is decked up for the festivities.
Deira Creek Opposit to Radisson Blue Hotel Deira, Dubai, United Arab Emirates Getting There ›
The ultimate elixir for any adventure junkie, Skydive is recognized amongst the world's best in aerial sports. Let go of all your fears as your instructor takes the charge, just take in the view of the iconic Jumeirah Palm or the Arabian Desert as you free-fall through the skies of Dubai.
December Timings At Palm Dropzone: Daily, 8 AM to sunset At Desert Dropzone: 8 AM - 5PM
Al Seyahi St, Dubai Deira, Dubai, United Arab Emirates Getting There ›
Desert safari
Traverse the beautiful expanse of the Arabian Desert and explore the allure of sand bashing, sand boarding, quad bikes, camel rides, belly dancers, authentic Arabic food, henna tattoos and what not. The best part of exploring all this in December is doing it in milder heat and humidity.
December Timings Morning desert safari: 5 AM to 9 AM Evening desert safari – 3 PM – 8:30 PM
Dubai United Arab Emirates Getting There ›
Hot Air Balloon
Floating 4000 feet above the ground is a special and once-in-a-lifetime experience. Dubai makes it all the more special as you get to marvel at the vastness of the Arabian Desert, witness a mesmerizing sunrise and adore the desert wildlife going about their business.
December Timings Daily from 5:00 AM – 9:30 PM
JLT,Cluster W, Dubai United Arab Emirates Getting There ›
As the name suggest you and a ‘cup' (read glass) of your chosen beverage, experience a bird-like feeling as you are hoisted 40 meters above from the ground. It offers a 30-minute multi-sensory ride that marries food, good company, and panoramic views of Dubai's shoreline.
December Timings Daily, 10 AM to 12 AM
Dubai in December : Events to look out for
National Day Festival
December 2-3, 2023 Patriotism is at an all-time high on National Day in Dubai, with amazing fireworks lighting up the sky and UAE flags displayed proudly everywhere. Every year on December 2nd, residents of the United Arab Emirates come together to celebrate their nation’s independence and unity. From traditional dances to modern concerts and activities, National Day in Dubai is one of the most exciting times to be in the city!
Burj Khalifa NYE Fireworks
December 31, 2023 at 11:58 PM There's no better place to be on New Year's Eve than at the Burj Khalifa! With an awe-inspiring display of fireworks lighting up the night sky, people from all over the world come to experience this one of a kind event. There are many great places to watch the show from, but there's nothing like being in the thick of it and watching the magical bursts of light and sound, firsthand.
Dubai Shopping Festival
December 8, 2023 - January 14, 2024 Whether you are a shopping fanatic or not, slashed prices upto almost 90% and amazing deals on fashion, electronics, jewelry, furniture, vehicles, toys, and even dining offers will make you one. Accompanied by dazzling fireworks, pop-up events and a host of concerts, the DSF is amongst the grandest shopping festivals in the world.
Expo City: Winter City
December 8, 2023 - January 7, 2024 Winter City at Expo City Dubai is the ultimate winter wonderland! As soon as you step inside, you'll be surrounded by a magical winter snowscape full of glittering snowflakes and shimmering icicles. From giant snow slides to ice skating rinks, Winter City has something for everyone – it's perfect for families, couples, and solo adventurers alike.
Dubai in December : 5-days itinerary
5 Days in Dubai Itinerary
Desert Safari
Aquaventure
Dubai Helicopter Tour
Green Planet
Dubai essentials.
Language Arabic
Time zone GMT+4
Country Code +971
Socket Type C, D and G
Currency Arab Emirate Dirham (AED)
Dubai in December observes a daily high temperature of 27°C, with an average of 21°C. The evenings cool down to around 18°C and rarely drop below 15°C. With only two days of the month expected to be wet, the rainfall is a low 0.6 inches.
Where to stay in Dubai during December
Famous for its hospitality, Dubai offers a plethora of options, from uber-luxurious to budgeted ones, including Airbnbs across the city. Depending upon your travel itinerary and budget, a range of hotels are available at your disposal.
- Luxury Hotels – Burj Al Arab , Al Qasr , One & Only Royal Mirage , Atlantis, The Palm , Kempinski , Ritz Carlton and Sofitel The Palm
- Budget Hotels – Amwaj Rotana Jumeirah Beach , Radisson Blu Hotel, Dubai Deira Creek , Crowne Plaza Dubai , and Carlton Downtown
What to pack for visiting Dubai in December
The days are usually sunny and evenings are comparatively chilly. Keeping both the weather and customs in mind, here's a comprehensive list of essentials to pack: lightweight clothing, a jacket (incase it gets too cold), lightweight cardigans for cooler evenings, party casuals and shoes for your night outs, a high SPF sun cream to protect from UV rays, hat/scarf/bandanas, sunglasses, swimsuit with coveralls, and comfortable shoes/flip-flops.
Getting around Dubai in December
Taxis are one of the most efficient and convenient options for commuting within the city. They can be hailed off the street or can be hired over the phone or via an app called RTA Smart Taxi. Note, they are quite expensive but easily available and comfortable.
Buses are a great way to get about the city and between the Emirates as well. Most buses are wifi equipped and charge a nominal fee, making for a great alternative to the expensive taxis.
Although Dubai metro is the most budget friendly way to explore Dubai. Since the Dubai metro mostly runs above the ground it offers a scenic view of the city as well. Do explore the Dubai Water Taxi at least once, it definitely makes for a unique experience.
Dubai in December - Must try delicasies
Hot dumplings with a crunchy crust and soft inside, soaked in sweet, sticky date syrup known as dibbs; they taste salty and sweet, at the same time. Get your hands on one of the most popular traditional Emirati desserts at Local Bites Café in Jumeira and Arabian Tea House in Sharjah.
A one pot wonder, it consists of boiled wheat with salt and tender chunks of lamb, mutton, chicken or veal. Cooked for hours to ensure the correct texture of wheat and flavor boost from meat and spice, authentic Al Harees is served at Khaneen Restaurant in Al Safa and Al Fanar.
A traditional Emirati rice dish packed with flavors of spices, dried lime powder, red meat, chicken or shrimp, onions, potatoes, tomatoes, and green peppers. Slow cooked for hours, authentic Machboos is available at Gulf Mandi on Al Khaleej road and Barjeel Al Arab on Al Ghubaiba road.
Available at various stores, try these freshly baked bakery version of the classic Arabic bread, Pita. It's a perfect accompaniment to fresh hummus and mutable, the aubergine dip. Visit the Arabian Tea House café in Bastakiya to witness its preparation through a glass window.
A vegan traditional Emirati salad served on Levantine bread, consisting of fresh lettuce, cucumbers, diced tomatoes, lemon, mint leaves, onion, garlic, and olive oil. You can find this refreshing salad at Al Halabi , Mall of the Emirates and Afiyet Olsun in Al Barsha.
- Pre-book: December is amongst the busiest times in Dubai, so to avoid any hassles, pre-plan your itinerary and pre-book so you don't miss on anything that you planned. Also pre-booking at various attractions can cut down your wait time and avail you discounts as well.
- Visit local markets: After you 've measured the pulse of modern Dubai, take a look at the traditional aspect by exploring souks, an Arab market. Notably, with traders coming from all over the Middle East you might score some great deals.
- Respect the customs: Though Dubai is a liberal city, you still need to respect their traditions and customs. First and foremost, refrain from any public display of affection. Women travelers should avoid shaking hands with locals unless the men offer to shake hands first.
- Dress code: You are free to wear whatever you like, provided it is appropriate for the location. Religious and official places expect that your shoulders and knees be covered. Bikinis are restricted to the beach and pool areas. Carry a shawl for cover-up, in case.
- Alcohol restrictions: As a general rule, only restaurants, discotheques, and pubs can legally serve alcohol in Dubai. Though there are no drinking restrictions for visitors, make sure you're not overly drunk as that is frowned upon and can lead to police intervention.
Planning to visit Dubai?
For more Dubai information, here are some helpful links!
See more Dubai. Save more money.
Save AED 20 on your first booking with Headout when you use promo code GODUBAI
Lakshmi Menon
Born to parents bit by the wander bug, Lakshmi calls her love for travel "hereditary and habitual". Perpetually ensconced with a book in her hand and a mug of coffee in the other, she has been to over 15 countries in her 23 years of existence and is currently saving miles and money for her solo trip to Iceland. Always hustling towards the least trodden path, she has encountered some wonderful people during her escapades and if you ever meet her, she won't stop gushing about them.
Be a smart traveler
The first to know about trending destinations, travel deals, tips and all things travel.
- PLAN YOUR TRIP
- OTHER EMIRATES
Dubai Weather in December 2023: What to Expect & Best Tips
Are you planning your trip and wondering about Dubai’s weather in December ? Great, then your search ends here! This post offers a comprehensive overview of Dubai’s climate in December , with details on average air and sea temperatures . Plus, you’ll find valuable tips on what to pack and exciting activities to make the most of your trip during this festive month.
December is undoubtedly one of the best months to visit Dubai , and this is no mystery. It is the liveliest month of the year, attracting thousands of tourists from all over the world for its mild climate, shopping events, and extravagant lifestyle. In December, Dubai enjoys mild and pleasant weather —a refreshing change from the hotter months—making it an excellent time for outdoor activities without the heat and humidity of summer.
It’s an excellent time to indulge in various activities, from exploring the mesmerizing desert landscapes through hot air balloon flights and the famous Dubai Desert Safaris , to enjoying the city’s vibrant water parks , exquisite attractions, exclusive restaurants, and lively clubs. Of course, the end of the month is the most anticipated time, with the world-famous Dubai New Year’s Eve and, incredibly, the many extravagant events of the Christmas in Dubai .
But be careful: December falls in Dubai’s high season . It is the peak of the high season , meaning that prices, especially for accommodation, tend to skyrocket. However, by booking well in advance, you can enjoy excellent hotel deals , whether it’s a luxury stay in one of the Hotels with Burj Khalifa Views or an enchanting Villas with Pool in Dubai . Sometimes, you might also find some excellent last-minute offers at attractive prices!
What you can find in this guide to Dubai Weather in December:
Dubai Weather in December: What to Expect
Dubai temperatures in december, dubai sea temperature in december, what to pack for a trip to dubai in december, what are the best activities to do in december in dubai.
As just mentioned, the weather in Dubai in December is ideal for visiting the city and its attractions. Temperatures are anything but wintry thanks to the sub-tropical climate of the UAE: a mild and sunny climate perfect for exploring the city and its beautiful surroundings, including the desert and other emirates such as Abu Dhabi , Sharjah , and Ajman .
When traveling to Dubai in December , you can expect good weather — a fairly mild winter with sunny days, clear skies, and temperatures still warm enough for sunbathing and swimming in the sea. While temperatures are lower than the scorching summer highs, they remain pleasantly warm, creating an ideal climate for outdoor exploration and fun . For most travelers, the sea water is still warm enough for a refreshing swim, and the beautiful golden beaches overlooking the Arabian Gulf are perfect for relaxing and sunbathing.
In December , occasional thunderstorms may occur, but they usually do not last long. In any case, rain typically doesn’t exceed one day for the entire month . Temperatures are perfect for enjoying outdoor activities such as jet ski or speedboat rides from Dubai Marina or quad adventures in the desert.
Dubai’s average UV index in December is 6 , which is considered moderate . If you have sensitive skin, it’s advisable to protect it from direct exposure to the sun. In December, the sun rises around 6:55 AM and sets around 5:30 PM . You may notice that popular places tend to be a bit busier, and prices generally higher, especially around New Year’s Eve . Indeed, this excellent combination of weather and liveliness attracts many travelers, marking the peak of the season.
Still wondering about Dubai’s weather in December? By continuing to read, you’ll find all the details on temperatures and climate , what to pack , and the best things to do . Embrace the charm of December in Dubai , where weather, holidays, and experiences come together to create a memorable travel adventure!
Dubai experiences an average temperature of 21 °C (70 °F) in December, with fluctuations ranging between a minimum of 16 °C (61 °F) and a maximum of 26 °C (79 °F). During the day, the weather is pleasantly mild, creating an ideal atmosphere for leisurely walks and the pursuit of thrilling adventures in Dubai. The city offers a myriad of exciting activities to explore.
As evening descends, temperatures may drop, presenting a slightly chilly ambiance . Nevertheless, this period provides a wonderful opportunity to immerse yourself in Dubai’s lively nightlife. One unmissable experience is dining aboard a dhow , a traditional wooden boat indigenous to the UAE. Daily dinner cruises are conducted along the Dubai Creek , meandering through the city’s historic neighborhoods. For a more contemporary and glamorous alternative , consider a dinner cruise amidst the dazzling ambiance of Dubai Marina .
Dubai experiences an average sea water temperature of 23 °C (74 °F) in December, providing a delightful opportunity for visitors to enjoy a refreshing dip in the crystal-clear waters of the Gulf. During this month, the sea water remains pleasantly warm, making it an inviting prospect for those seeking aquatic activities. While some tourists, especially families with children , may opt for the exhilarating experiences offered by Dubai’s renowned water parks , such as Atlantis Aquaventure and Wild Wadi Waterpark , others might venture to Abu Dhabi’s Yas Waterworld .
For enthusiasts of snorkeling or diving , the Fujairah area, situated on the Gulf of Oman , stands out as a premier destination, renowned for being one of the Gulf’s best diving spots. Alternatively, if swimming with dolphins and marveling at breathtaking landscapes piques your interest, seize the opportunity for a day trip to the Musandam Peninsula . This picturesque location promises an unforgettable experience amidst stunning natural beauty.
In Dubai, daytime temperatures tend to be quite warm, making shirts , trousers , or jeans suitable attire. However, as the evening approaches, it can become chilly, so it’s advisable to pack a sweater or something similar to stay comfortable. For a well-rounded wardrobe, consider including more elegant clothing , especially if you plan to explore Dubai’s vibrant nightlife. Exclusive clubs and restaurants, such as those at the iconic Burj Al Arab , may have a dress code that calls for a more refined style.
To fully enjoy the luxurious and diverse lifestyle Dubai has to offer , it’s a good idea to be prepared for various occasions. Whether you’re dining at a high-end restaurant or dancing the night away at a chic club, having a more sophisticated outfit on hand can enhance your experience. And, of course, don’t forget to pack your swimsuit ! Dubai is known for its stunning beaches and luxurious poolside settings, so having swimwear is essential for a well-rounded visit.
If this is your first time visiting Dubai, consider reading the Dubai Dress Code guide for additional insights into local customs and fashion norms. This will help you navigate the city with confidence and ensure that you are appropriately dressed for any occasion.
Furthermore, if you are not a resident or citizen of the UAE, seriously consider taking out a good travel insurance for the UAE covering most common health issues. It may be a requirement for those who need a visa , while it is not currently mandatory for those who do not require a visa. Still, it is highly advisable because medical bills in the UAE can be enormously expensive , even for common accidents or illnesses, such as a simple case of gastroenteritis.
December stands out as one of the prime months to experience Dubai’s charm and revel in its captivating attractions . Check out our comprehensive Dubai Travel Guide , tailored to ensure an enriching trip to Dubai, featuring a myriad of activities and insights from the locals. Embark on an unforgettable safari in the Dubai Desert , where the golden sands and dunes create a breathtaking backdrop. Elevate your experience by ascending to the summit of the iconic Burj Khalifa , offering panoramic views of the city.
Read More: DUBAI NEW YEAR’S EVE – Top Things to Do and Best Celebrations
Delve into the modern and vibrant ambiance of the Dubai Marina district, where a plethora of exciting activities await. For a touch of romance, embark on a memorable dinner cruise along Dubai Creek , where the city lights create a magical setting. Extend your exploration beyond Dubai with a day trip to Abu Dhabi and other picturesque cities in the emirates. The most cost-effective and convenient way to do so is by renting a car . You can find lots of valuable tips in our guide to Car Rentals in Dubai , along with suggestions for potential destinations to explore. Make the most of your December visit to Dubai by immersing yourself in these captivating activities and creating lasting memories.
The Weather in Dubai Month by Month
Find out what is the Best Time to Visit Dubai with our month-by-month guide , with all the information on weather and temperatures and the best tips from locals on things to do and see! Discover the climate of Dubai and the United Arab Emirates and organize your trip consciously, always packing the right gear and including the best activities depending on the season in your itinerary!
Are you planning your trip? These tips may come in handy: THINGS TO DO AND SEE IN DUBAI USEFUL TIPS TO KNOW BEFORE YOU GO TO DUBAI GUIDE TO THE BEST CAR RENTALS IN DUBAI AND ABU DHABI
- Top Things to do
- Dubai Tours
- Attractions
- Burj Khalifa Tickets
- Aquaventure Tickets
- Dubai Miracle Garden
- IMG Worlds of Adventure Tickets
- Dubai Frame Tickets
- Dubai Desert Safari Tours
- Dubai Aquarium Tickets
- Ski Dubai Tickets
- The View at The Palm Tickets
- Dubai Safari Park Tickets
- Xline Dubai Marina Zipline Tickets
- Museum of the Future Tickets
- Green Planet Dubai Tickets
- AYA Universe Tickets
- Jebel Jais Zipline Tickets
- Dubai Dhow Cruises
- Dubai Garden Glow Tickets
- Motiongate Tickets
- Sky Views Observatory Tickets
- Walking Tours
- Guided Tours
- Hop-On Hop-Off Tours
- Theme Parks
- Water Parks
- Religious Sites
- Observation Decks
- Things to do
A Guide to Visiting Dubai in December | Attractions, Malls & More
Dubai is undoubtedly one of the most popular and coveted vacation destinations in the world. This city has it all, from the world's tallest building to the world's second-largest retail mall. It is a destination for individuals from all over the world looking to spend their vacations in comfort and extravagance. From spectacular vistas to luxurious accommodations, desert safaris to beaches, indoor-outdoor adventures to unrivaled shopping, Dubai has it all to make your vacation the greatest it has ever been. While the city is inviting all year, the best time to visit is in December, when the weather is comparably colder and the city is buzzing with activities and festivities.
Is December a Good Time to Visit Dubai?
There’s a lot to enjoy about Dubai in December, particularly the calming weather and the many events lined up for the holiday season.
Why You Should Visit
- On several days throughout December, particularly the 25th and 31st, Dubai is beautifully lit with fairy lights and mesmerizing pyrotechnics.
- The Dubai International Film Festival, Dubai Shopping Festival, and UAE National Day Festival are just a few of the activities that take place throughout December in Dubai.
- December is an excellent time to visit Dubai owing to the pleasant tropical weather.
What to Look Out For
- If you’re looking for a typical winter holiday experience, Dubai is not the place for you since it doesn’t get cold even in December.
- Owing to the great weather, December is one of the busiest months in Dubai and the most crowded too.
- Hotel and flight tickets may be higher than usual due to peak tourist season and end-of-year festivities.
Overview of Weather in Dubai in December
Dubai has a tropical desert climate thanks to its location in the Northern Desert Belt. The weather in December is pleasant, making it ideal for sightseeing and outdoor activities. In December, the temperature in Dubai fluctuates from 26°C to 14°C.
- Average Temperature: High - 26ºC Low - 14ºC
- Average Rainfall: 0.4-1.7 inches (approximately 1 of rain)
- Daily Wind Speed: 7.9 mph
- Temperature of the sea : 23ºC
More About Weather in Dubai in December
How cold is Dubai in December?
During the month of December, the average temperature in Dubai ranges from 24°C to 30°C. As a result, even in December, Dubai has a dry and hot climate.
Can You Swim at Beaches in Dubai in December?
Yes, you can swim and participate in a variety of water sports in Dubai in December. The water temperature is 23°C, which is ideal for swimming.
Does it rain in Dubai in December?
Dubai in December is hot and dry with almost no rain.
Is Dubai Windy in December?
No, winds very rarely rise beyond light to moderate breezes in December.
Best Things to do in Dubai in December
1. Burj Khalifa
City landmark | world's tallest building.
If you visit Dubai, the iconic Burj Khalifa is visible from every vantage point. This 825-meter-tall man-made technical marvel offers a stunning panoramic view of the city. Don't forget to pop down to the Burj on December 31st to witness a stunning light and sound spectacle. There's really no better way to begin the new year with your loved ones!
2. Desert Safari
Adventure activities | traditional activity.
One of the coolest things to do in Dubai in December is going on a desert safari. You can tour the enormous Arabian Desert and engage in a variety of desert activities such as sand bashing, sandboarding, quad biking, and even camel ride. Also, spend the night in one of the Bedouin tents, enjoying folk songs, watching belly dance, and savoring local cuisine.
3. Dhow Cruise
Sightseeing | dinner cruise.
Navigate the Dubai Creek in a wooden Dhow to get a sense of the city's true spirit, where 21st-century marvels coexist with traditional Arab charm. During December, when the city is decked out for the holidays, the vistas from the two-hour cruise are significantly enhanced. The journey takes place in an authentic wooden Arab Dhow that exudes classic Bedouin charm as it floats along the Dubai Creek.
4. Dubai Safari Park
Zoo | learning experience.
The Dubai Safari Park, which was built to replace Jumeirah Zoo, is a diverse reserve that spans 119 hectares. Hundreds of exotic animals can be seen up close and personal at the park, offering tourists a once-in-a-lifetime opportunity. There are about 2,500 animals in the park, representing 250 different species including lions, tigers, hippos, flamingos, chimps, reptiles, and much more.
5. Dubai Aquarium
Aquarium | learning experience.
The Dubai aquarium is a must-see for anyone who visits Dubai. It's one of the largest aquariums in the world, and it's home to a variety of aquatic animals. The aquarium has over 16,000 creatures including terrifying sharks, shy sea turtles and sleek rays. With water levels at almost 4 meters deep, multiple entrances allow for better viewing of all the creatures.
6. IMG Worlds of Adventure
IMG Worlds of Adventure is a theme park made up of 4 different zones: Marvel, Lost Valley - Dinosaur Adventure, IMG Boulevard and The World. Each zone has a set of rides and attractions designed to fit the theme for the child in you. Even if you don't have kids it's still worth visiting IMG Worlds of Adventure for the rides and attractions based on your favorite superheroes.
7. Dubai Frame
City landmark.
With a height of 150 meters, Dubai Frame offers a bird's eye view of the city's iconic and stunning skyline. You can witness Old and New Dubai and learn about how the city has evolved into a one-of-a-kind metropolis. Enjoy the sparkling skyline of Dubai that’s illuminated for the holiday season and witness stunning vistas.
8. La Perle Show
Live show | entertainment.
The La Perle Show, designed and created by the great Franco Dragone, is visually stunning and provides spectators with a mesmerizing experience. The theatre is one-of-a-kind, with more than 60 world-class performers doing incredible exploits and feats throughout the play. If you're visiting Dubai with your kids, this is a must-see attraction.
9. Dubai Miracle Garden
Garden | tourist hotspot.
The Dubai Miracle Garden is one of the most beautiful places in Dubai. It is a 72,000 square meter garden with over 45 million flowers. The flowers are arranged in beautiful displays that change with the seasons. The garden is a popular tourist attraction and also one of the cheapest attractions in the city for you to enjoy.
10. Skydiving
Skydiving | adventure activity.
For all thrill-seekers, skydiving in Dubai is one of the must-do activities among many others. Jump into the air from nearly 14,000 feet and come crashing down to the ground before being dragged away by your parachute. Book your skydiving experience tickets much in advance to get your preferred slot.
11. Dubai International Film Festival
Film festival.
The festival's goal is to recognize cinematic greatness while also encouraging open discussion across cultures and nations. Encourage and develop local and international talent, driving and promoting the industry's growth while also offering a valuable cultural benefit to the people of Dubai and the UAE.
12. Jumeirah Mosque
City landmark | mosque.
The Jumeirah Mosque is one of the most popular tourist destinations in Dubai. It's known for its intricate architecture and beautiful design. The mosque is open to tourists from all religions, and it's a great place to learn about Islamic culture, history, and the mosque's significance in Emirati culture.
Top Experiences & Things to do in Dubai in December
Events in dubai in december.
The Dubai Marathon
Date: 10 Dec, 2022
The Dubai Marathon, one of the major events in the Middle East, is a must-see for anybody visiting the United Arab Emirates. It is frequently referred to as the wealthiest marathon in the world since it offers a prize pool of approximately $1 million for anyone who sets a world record. The event attracts tens of thousands of people. During the event, there are also 10-kilometer and 4-kilometer races.
Dubai Rugby Sevens
Date: Nov - Dec
The Dubai Exiles Rugby Club hosts the first round of the IRB Sevens Series every year, with 16 foreign teams fighting for the famous trophy over three days. The three days of competition are supported by a variety of additional entertainment and festivities designed to keep visitors of all ages entertained, while those new to rugby will enjoy the fast-paced contests.
Dubai Desert Classic
When : Dec - Jan
The Omega Dubai Desert Classic is a first-class yearly sports event in Dubai where the world's top swingers hit the ball straight into the hole with the perfect stroke. Every year, the tournament is held to promote both casual and professional golf tours in Dubai. If you love the game, go to the golf field as a spectator.
Shopping in Dubai in December
Dubai Shopping Festival: 15 Dec - 29 Jan
The magnificent Dubai Shopping Festival attracts visitors from all over the world, and if you are a shopaholic, you must prepare to experience the stunning festival. The dates for the 2022 Dubai Shopping Festival are 15 December 2021 to 29 January 2022. Because this is a city-wide celebration, it can be experienced in a variety of venues. Global Village, Mall of the Emirates, Al Rigga Street, The Layali Dubai Concert, Night Souk, and Dragon Mart are among the locations for the Dubai Shopping Festival. Know more >
Know Before You Visit Dubai in December
- Time Zone : GMT +4
- Currency : Arab Emirate Dirham (AED)
- Country code: +971
- Emergency numbers: 999 (Police), 998 (Ambulance), 997 (Fire Department)
What to Wear in Dubai in December
- Lightweight clothing since it’s relatively hot during the day
- A jacket in case it gets too cold
- Lightweight cardigans for cooler evenings
- Party casuals and shoes for your night outs if you’re visiting around Christmas or New Year’s
What to Pack in Dubai in December
- Power Adapter: Type C, D, And G
- A high SPF sun cream to keep away UV rays, hat or scarf of bandanas, sunglasses, swimsuit with coveralls, and comfortable flip-flops or shoes.
- A daypack with enough pockets for all of your items to be carried around during the day.
Getting Around Dubai in December
By Metro: The Dubai metro is the most cost-effective way to see the city. Because the Dubai metro runs primarily above ground, it provides a spectacular view of the city. Metro map.
By Taxi: Taxis are one of the most cost-effective and handy ways to get around the city. They can be flagged down on the street, or rented over the phone or through the RTA Smart Taxi app.
By Bus : Buses are an excellent means to navigate throughout the city as well as between the Emirates. The majority of buses have wifi and demand a small price, making them a perfect alternative to expensive cabs. Bus map.
By Boat: At least once, take a ride on the Dubai Water Taxi; it's a very unique experience.
Where to Stay in Dubai in December
The modern city of Dubai offers various options for accommodations. Explore our list and opt for the hotel that suits you!
- Budget Hotels : Radisson Blu Hotel, Carlton Downtown, Amwaj Rotana Jumeirah Beach, Dubai Deira Creek, and Crowne Plaza Dubai
- Mid-range: Marina Crown Tower, Intercontinental Dubai Marina, Dallas Hotel
- Luxury Hotels: Atlantis, The Palm, One & Only Royal Mirage, Burj Al Arab, Sofitel The Palm, Al Qasr, Kempinski, and Ritz Carlton
What to eat in Dubai in Decemeber
Dubai is a true foodie's paradise with lip-smacking cuisines from all corners of the globe. Explore the best Emirati cuisine and try a few international dishes during your time at this amazing city.
- Manousheh: People with savory taste buds will like Manousheh, the native Dubai pizza. Exotic toppings like salty Akkawi cheese, earthy zaatar herbs, and olive oil are stuffed into stretched dough or flatbread.
- Chelo Kebab: Chelo Kebab is a kebab served with delicious saffron-scented basmati rice and a pat of butter. It is said to be out of this world and delicious.
- Al Machboos : Due to the zesty flavors, this is considered the most famous food in Dubai. This classic recipe combines rice, onions, and beef, all seasoned with spices, salt, and dried lemon.
Hacks & Tips to Visit Dubai in December
- December is one of Dubai's busiest months, so plan and book ahead of time to ensure you don't miss out on any of your scheduled activities.
- You may wear whatever you want as long as it is appropriate for the occasion. Shoulders and knees must be covered in religious and official settings.
- After you've got a flavor for modern Dubai, head to the souks to get a feel for the old. Specifically, with traders from all across the Middle East, you may be able to get some fantastic discounts.
- In general, only restaurants, discos, and pubs are permitted to serve alcohol in Dubai. Although there are no drinking restrictions for tourists, make sure you're not too tipsy.
- Even though Dubai is a liberal city, you must respect its traditions and customs. First and foremost, avoid public displays of affection in any public location.
Explore Dubai Through The Year
All your questions about visiting dubai in december answered.
Yes. When it comes to visiting Dubai , December is one of the best months of the year. The weather is hot and humid, but not as hot as it is during the summer months. During this time of year, there are also several festivals and events to attend.
Some of the best things to do in Dubai in December include visiting the Burj Khalifa , taking a dip at Aquaventure Waterpark, and ending the day with a romantic Dhow Cruise .
In Dubai , December is not particularly cold. The temperature is normally in the mid-20s during the day and drops to the mid-10s at night. You won't need any winter clothing, although a light jacket would suffice.
Dubai is hot and dry in December, with hardly any rain. With eight hours of daylight per day, you'll have plenty of time to explore this fascinating city.
Swimming in Dubai and the surrounding area is lovely in December. The average sea temperature is 78°F, which allows you to swim for lengthy periods and participate in water sports.
In December, Dubai receives approximately 11 hours of daylight daily, with an average of eight hours of strong sunshine, making Dubai an excellent winter sun destination.
If you're visiting Dubai in the winter, bring a pair of long pants or a long skirt, as well as a sweater. A light jacket is also recommended, particularly if you plan on going on any evening adventures on the water or in the desert.
The average rainfall in Dubai in December is 15 mm (0.59 in), with rain falling on only two days out of the month.
In general, Dubai's prices are similar to those in other major cities throughout the world. Accommodation and activities can be costly, but there is so much to choose from that you can make it more affordable if you want to.
Dubai boasts some of the lowest crime rates of any city in the world and is regarded as one of the safest destinations to visit.
You must visit the Burj Khalifa, Dubai Aquarium, Dubai Safari Park, Dubai Frame, and other great attractions in Dubai in December.
Some of the major events in Dubai in December are the Dubai Shopping Festival, Dubai International Film Festival, Dubai Desert Classic, The Dubai Marathon, and more.
Temperatures in Dubai in December range from 16°C to 26°C, with an average temperature of 21°C.
Visits to KidZania, Wild Wadi Water Park, Dubai Aquarium & Underwater Zoo, Dubai Dolphinarium, and the Burj Khalifa are some of the best things to do with kids in Dubai in December.
Dubai Weather in December: Everything You Need to Know
What to expect when visiting dubai in december.
Take me back to November Weather in Dubai | Jump forward to January weather in Dubai
As Dubai slips gracefully into a mild winter, December has historically ranged from highs of 28 ° C/82.4 ° F at the start of the month through to 25°C/77°F at the end of December.
Dubai’s average daytime temperature in December is 26°C/78.8°F.
Days are typically clear and sunny but there is a small chance of rain and thunderstorms – 8 hours a day of sunshine a day is forecast.
Overnight in the city, you can expect the temperature to lower between 18 ° C/64 ° F to 15 ° C/59 ° F. This can be a little cooler overnight if you are heading into the desert.
Dubai Sea Temperature in December
In December, you should expect sea temperatures on average of 25.6°C/78°F (Maximum sea temperatures are expected of 28.5°C/83.3°F through to a minimum of 23.8°C/74.9°F).
- For more on what’s happening in Dubai in December, check out this page.
Other weather patterns that are common in Dubai in December
Fog is a common occurrence in Dubai in December, which can cause chaos with transport at times. It’s not a regular occurrence, but it’s always something to be mindful of.
It’s also not unusual to experience winter rain showers in December – 20mm falls in December on average. Packing an umbrella is probably an unnecessary extra item of luggage. If you’re unfortunate enough to be caught in the rain you may be able to borrow one from your hotel, sit it out to the rain stops or buy one!
Information sourced from the UAE National Centre of Meteorology climate report 2003-2018 for Dubai International Airport.
What should I pack for December in Dubai?
It’s probably going to get cool enough in the evenings that you can pack longer jeans/trousers and bring some sort of pullover, especially if you plan a trip into the desert.
You can read more about what to pack in December for Dubai here.
Before you go… More important things you should know when planning a trip to Dubai
- Pop into our essential planning information page, it includes everything you need to know about getting around Dubai , a handy guide on what to pack , and top tips for first-timers on the do’s and don’ts, laws, and customs to be aware of.
- Check out this incredible list of 150+ places you should visit when you’re in Dubai .
- Pick up a Dubai Pass from iVenture or a Go City Dubai Pass to save up to 50% on top Dubai attractions.
- Don’t forget to pack your travel insurance !!!
- Discover the best areas to stay in Dubai , or bag a bargain on your accommodation here:
Take me back to the Dubai Travel Blog
Please note we are not a travel agency. This site is a travel blog to help newcomers to the UAE and transit passengers self plan their trip, we cannot book your flights, hotels, visas or connections for you. We may make a small commission if you click on any of our recommendation links . Dubai Travel Planner
You may also like
Understanding ramadan rules in dubai as a tourist..., free airline buses from dubai to abu dhabi..., sharjah airport to dubai airport: need to know..., how to get from dubai airport to dubai..., dubai water taxi & dubai water bus explained, dubai mall dress code: the rules explained &..., leave a comment cancel reply.
Save my name, email, and website in this browser for the next time I comment.
Vacations in Dubai
Search hundreds of travel sites at once for vacation package deals in dubai.
Let KAYAK do the searching
Save on your next vacation
Search and compare hundred of travel sites at once for vacation packages in Dubai
We’re completely free to use - No hidden charges or fees
Filter by free cancellation, free breakfast and more
Cheap Dubai package deals
Most popular dubai flight and hotel deals, all inclusive vacation packages to dubai, last minute vacation packages to dubai, search by stars, search by review score, search by board, search by price, search by freebies, when to book a vacation in dubai, tips for finding dubai package deals.
- There are loads of types of vacations in Dubai and the cost will depend on what type of trip you’re taking and for how long you’d like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $666; Family vacation $593; Romantic vacation $805; Luxury vacation $759; Budget vacation $462.
Why should you book a vacation package to Dubai?
With a good Dubai vacation package, you can experience this Persian Gulf emirate's famous 4X4 Desert Safaris and races, visit the Burj Khalifa, skydive over the world-famous Palm Jumeirah Island or take your kids to the Dubai Sky Polar pass or Dubai Atlantis Aquaven
When should you book a vacation package to Dubai?
The winter season in Dubai is the perfect time to take a vacation on the white sands of the Persian Gulf. From November to March it's the rainy season, which is the only cool period. The rains are short lived, however. Book your stay in advance to get the best Dubai package deals.
Where should you stay in Dubai during your vacation?
For any vacation type in dubai:.
Rove Downtown Dubai "is made for social media." The special hang out lounge features comfy sofas, a wall full of artworks and an eclectic collection of bric-a-brac. Many of the spacious rooms feature interconnecting doors perfect for families, 48-inch interactive TV screens, sofa beds for extra guests, a mini fridge, secure safe and in-room coffee and tea stations.
Located at the further end of Dubai Marina, Grosvenor House is a sophisticated twin tower hotel designed with marble floors, plush carpets, and mahogany furnishings. It's famous for offering the best Asian spa, heated pools, free spacious parking, a superb club lounge, airport transfers and shuttle bus services, and more.
For family vacations in Dubai:
The JA Jebel Ali Beach Hotel is a family-friendly resort located on the shores of the Persian Gulf. It offers a 9-hole golf course and horse riding. The breakfast-inclusive stays give your family access to temperature controlled swimming pools, shuttle bus services, and airport transportation.
Popularly known as the "House By The Sea," the Beit Al Bahar stand-alone villas offer complete privacy for your family. The hotel offers bed and breakfast, shuttle bus services, dry cleaning services, WiFi and room service, and is located in Jumeirah St next to the Wild Wadi Waterpark.
For romantic vacations in Dubai:
Located at the entrance to Jumeirah Island, the FIVE Palm Jumeirah Dubai Hotel is the perfect hideout for couples who want to reignite their passion and create their own epic stories at the beach while sharing inspiring moments. The hotel has a contemporary architectural design, has shuttle bus services, airport transfers, hot tub and air conditioning in all rooms, as well as plenty of parking space.
Atlantis, the Palm Hotel is a gem of sheer beauty located off Crescent Road. Atlantis provides breakfast, airport transportation, and dry cleaning services. The award-winning chef restaurants, aquarium and waterpark, and the Ocean Deluxe rooms are a must experience for couples.
For luxury vacations in Dubai:
With rotating beds that have a view of the city, the Burj Al Arab is the most luxurious hotel in Dubai. The opulent interiors are designed with towering golden pillars and stairs made of marble and gold. The hotel's Dubai travel package gives you the opportunity to arrive by helicopter, experience VIP services and have a 24-hour private butler.
The one and only Palm Dubai offers peace and tranquility in Dubai's breathtaking western portion of the Palm. Enjoy the bed and breakfast, Moorish and Andalusian design terraces and balconies or a suite with a private plunge pool.
For budget vacations in Dubai:
City Max Hotel Bur Dubai offers value for money comfort with breakfast, in-room refrigerators, access to an outdoor pool and free parking included in its Dubai vacation packages
Located a few meters from Dubai Creek, the 4-acre Arabian Park Hotel offers free and ample parking, an outdoor pool, bar/lounge, quiet surroundings, a shuttle bus service, and transport to and from the airport.
Where to stay in Dubai
Dubai vacation information, other popular package vacation destinations.
- Boston package vacations
- Bermuda package vacations
- Saint Lucia package vacations
- San José del Cabo package vacations
- Phoenix package vacations
- Atlanta package vacations
- Dublin package vacations
- Saint Thomas Island package vacations
- Belize package vacations
- Nashville package vacations
Dubai in December
This post may contain affiliate links.
Dubai in December and at Christmas is warm to hot, temperatures are quite pleasant and it doesn’t get cold. Dubai is in the Northern Hemisphere so December is winter in Dubai. It’s winter or Christmas vacation time for many of us in Europe, America and parts of Asia. The 2-3 week Christmas school holidays are starting, so is December a good time to visit Dubai for a vacation? Yes, December in Dubai can be very pleasant, with the start of December being warmer than the end of December and into the new year.
December in Dubai
December brings some of the lowest year-round temperatures to Dubai and the United Arab Emirates. Dubai is cool in December, or not quite as hot! Depending on how used to heat you are. December is not the coldest month in Dubai, the coldest month is usually January. Let’s look at what to expect in Dubai in December, weather, humidity, and activities in Dubai in December. Most attractions in Dubai will be open in December, if you’re not looking for scorching hot beach days and sunbathing, December in Dubai could be perfect for you.
Dubai Climate
Dubai has a hot desert climate and does experience the four seasons, spring, summer, autumn, (fall) and winter. Winter conditions in Dubai last from about the end of October to early April, so December falls in the middle of winter in Dubai.
Northern Hemisphere “official” winter stretches from 22nd December 2022 to 23rd March 2023. The winter solstice falling on Dec 21st , the shortest day of the year. This is the astronomical winter, not the meteorological winter.
The urban heat effect raises temperatures a little in Dubai city and other cities in The United Arab Emirates and the Gulf Area.
The Tropic of Cancer (the northernmost extreme of the tropical zone) passes through The United Arab Emirates, within the Emirate of Abu Dhabi, making Dubai just outside the tropical zone and inside the temperate zone. Dubai is not in the tropics.
Dubai Temperatures in December
Dubai experiences some of its coolest temperatures in December, daytime and nighttime temperatures are fairly moderate for The Middle East at this time. This is a very good time to enjoy outdoor activities in Dubai, you may even need a light fleece or sweater after sundown, as temperatures can fall to a very pleasant 14C at night.
Average December maximum temperatures in December can be up to 28C (82F) In the hottest months, July, August, and September, temperatures in Dubai can hit 50C (122F), so December is much more pleasant temperature-wise.
Humidity rises through December, so by the end of December temperatures may actually feel hotter. Relative humidity is a moderate 56%. Dry heat is much easier to cope with than humid heat.
December is one of the wetter months in Dubai, but the chance of rain remains low.
February is usually the most humid month in Dubai (65%), May is the least humid (53%). July humidity is about 58%, rising towards August. The higher the humidity, the hotter it will feel.
April and May are likely the best months to visit Dubai for low humidity. The best time to visit Dubai is normally considered to be November to February, but I’d stretch that out to Easter, personally.
Dubai’s air quality is also variable. Check Dubai’s National Air Quality Monitor here.
Dubai in December Dust and Sand Storms
You are fairly unlikely to encounter a dust or sand storm in Dubai in December. Dust storms, winds carrying dust and sand, do affect Dubai. It’s not too unpleasant to experience one of these in Dubai so long as you can stay indoors, we’ve been in Dubai during one, but dust and sand will accumulate everywhere and driving may be affected. We’ve experienced one on a cruise ship in Dubai. Sand storms are most common in Dubai in summer or turbulent weather during the transition of seasons. You can check for dust storm forecasts in the UAE here on the official UAE forecast website.
Things To Do in Dubai in December
In December in Dubai you can take advantage of Dubai’s indoor and outdoor activities, giving you plenty of choice! Dubai is famous for its malls, water parks, theme parks and beaches, plus camel safaris, desert camps and cultural activities. Most of Dubai’s attractions should be comfortable for you in December and at Christmas. December is a good time to visit Dubai’s souks, maybe get some Christmas shopping done!
The Dubai Desert Safaris and Camel Safaris should be operating, with sunset temperatures dropping to cool as darkness falls. These events are mostly held around sunset and the desert camps, dancing and dining are after dark. You may need a light sweater if you feel the cold. You book a desert safari to include the activities you prefer, for instance dune bashing, camel rides, quad bikes, sand surfing, and round the evening off with dining and a show (belly dancing plus more). Check out these tours here, and book in advance, these are so good! These tours will generally pick you up from your hotel in Dubai.
Here’s a list of more things to do in Dubai in December.
Ski in Dubai
Ski Dubai is located in The Mall of The Emirates and is open year round. It’s not just air-conditioned, this indoor ski resort is held at a cool -1 to 2 C, around freezing point. You’ll need warm clothes to meet the resident penguins or take a ski or snowboard lesson. This could be fun in Dubai in December. Ski Dubai was the first such ski facility in the Middle East. You can reserve timed ski session tickets here for kids or adults.
Visit the Museum of The Future
This brand-new attraction is the hot ticket in Dubai right now. This is one you simply can’t miss. Book your time slot here. (likely to sell out, so do book.) Or just click through on our link to see this incredible construction.
We haven’t visited this new museum ourselves as yet, we can’t wait to see it!
Go Up The Burj Khalifa
The observation tower inside the Burj Khalifa is another hot ticket in Dubai. If you have no fear of heights, this is a great thing to do. The Burj Khalifa is adjacent to Dubai Mall and many great restaurants which will have outdoor seating in December. It has a view of the incredible dancing fountain show. To watch the fountains in December, you should be comfortable outdoors! Book a time slot here.
Enjoy Dubai’s Aquaria
The Dubai Aquarium and Underwater Zoo is at Dubai Mall and is a great thing to do in Dubai at any time od year. A trip to an aquarium could be a great Christmas treat for your kids. This Aquarium has one of the biggest tanks in the world (over 10 million litres) and offers backstage tours plus opportunities to dive in the tanks, it’s home to many species from around the world, including crocodiles and penguins. You can see some of this main tank from The Mall without paying for admission. But we recommend you do go inside! Book here.
Aquaventure Dubai has what was the UAE’s biggest Aquarium at Atlantis (Abu Dhabi now has a huge one). We strongly recommend you consider staying at Atlantis, The Palm , to experience this. Alternatively, you can book a 1 day pass , and enjoy the winter temperatures. It’s not always sunny in Dubai in December, so if it’s overcast, windy or even raining, you may be a little chilly at Dubai’s water parks or at the beach.
Visit Dubai’s Green Planet Biodome
The Green Planet Biome in Dubai is an indoor rainforest. Temperatures are warm, between 24C and 28C, but that may still be cooler than outside in December! Book tickets here.
Visit a Dubai Theme Park in December
Most of Dubai’s theme parks will be too hot for average people outside in summer, but December should make them just fine to visit. Dubai also has an indoor or partially indoor theme park or two up its sleeve, with air-conditioned rides and areas.
The biggest and best indoor theme park in Dubai is arguably IMG Worlds of Adventure. It’s actually billed as the biggest indoor theme park in the world at approx 1.5 million square feet. IMG Worlds of Adventure features the characters and themes of Marvel Comics and the Cartoon Network, adding appeal to kids young and old, plus teens and adults.
It has four zones (Cartoon Network, Marvel Universe, IMG Boulevard and Lost Valley – Dinosaur Adventure) feature thrilling, scary, and gentle rides suitable for toddlers.
This amusement park is temperature-controlled and open all year, so yes, you can visit IMG Worlds of Adventure in December.
It is located at Sheikh Mohammed Bin Zayed Road, near Arabian Ranches, adjacent to Global Village, a huge shopping, leisure and entertainment attraction Global Village is open in December (it’s open from October to April), so unfortunately you can’t visit in summer. Check their website for schedules and events in December.
Legoland Dubai, at Dubai Parks and Resorts, is also partially indoors. Legoland Dubai comprises a theme park and water park. This Legoland’s Miniland (recreations of local and international buildings, in Lego) is indoors and air conditioned. It’s the only indoor Miniland at any of the world’s Legolands. Legoland is only open to 6 or 7pm so you can’t visiting in the late evening as you can for some other Dubai parks. Legoland is open year round with some seasonal fluctuations in times.
Bollywood Dubai, an Indian movie, or Bollywood themed park is also at Dubai Parks and Resorts. Most rides are indoors but the park itself is outdoors. you can visit quite late into the evening (10 or 11pm).
Motiongate Dubai is also nearby and is open all year with seasonal fluctuations. It is a Hollywood-inspired theme park. The zones are inspired by Columbia Pictures, DreamWorks Animation, and Lionsgate and offer rides for kids and families. Motiongate Dubai should be open in December and most of the rides are indoors. The Dreamworks park within a park is entirely indoors and airconditioned.
In summary, the parks at Dubai Parks and Attractions are:
- Bollywood Parks Dubai, Legoland Dubai, Legoland Water Park Dubai, Riverland Dubai, Motiongate Dubai
If you’re looking for a hotel at the Dubai Parks and Attractions, Lapita Resort is a moderately priced Dubai hotel, with a Polynesian theme near Dubai’s theme parks at the Dubai Parks and Resorts area. Theme park access can be included in your room price, making it an affordable option. This hotel has a kids’ concierge, kids club, teens club, and afternoon teas plus pool and lagoon. Family rooms and Royal suites make it family-friendly if you’re planning a family holiday in Dubai.
If you’d like to step back in time from the mega malls, discover Dubai as it was in the area called “Old Dubai” near the banks of The Creek.
You can take cultural tours here, visit the gold souk by crossing The Creek on a traditional boat (abra), see how houses were constructed in days gone by and visit a mosque.
We highly recommend you book a cultural tour of ld Dubai here (with food) and explore further yourself, on foot and by boat. Book that tour here. There is great shopping for souvenirs here. It shouldn’t be too hot to be outdoors in Dubai in December!
Dubai’s Garden Attractions
Dubai Garden Glow and Dubai Miracle are exotic garden attractions in Dubai. Dubai Garden Glow will likely be closed from mid July 2022, we have been unable to determine if it will be open for December.
Dubai Garden Glow also features a dinosaur park. Dubai Miracle Garden is only open in winter so should be open this December. Check for Garden Glow opening here.
Kidzania Dubai
Kidzania Dubai is located on level 2 of the giant Dubai Mall and will likely keep your kids busy all day in air-conditioned luxury.
Kidzania parks are replica cities, built for kids. There are other kids’ attractions within the Dubai Mall too, including giant slides and amusements.
The Mall is a very good place to spend a December day with your kids! Book all of the other Mall attractions and make a day of it.
Enjoy Art at The Mall
At the Dubai Mall again, on level 2, you will find some spectacular art exhibits.
Go to the Dubai Opera
The Dubai Opera House is at Sheikh Mohammed bin Rashid Blvd, Downtown Dubai and is a popular spot for architectural tours as well as performances. The building is spectacular and a destination in its own right.
Go to Ferrari World
Ferrari World is in Abu Dhabi. See our post on getting from Dubai to Abu Dhabi, and Abu Dhabi attractions.
Take in a show, La Perle by Dragon
Dubai’s #1 show is at Al Habtoor City, Dubai. Find out more and book tickets, which can be combined with other attractions, here.
Indoor Play at Oli Oli
Oli Oli is “An Experiential Indoor Play Museum” in Dubai, for kids. All ages are welcome. Learn more about Oli Oli here
Try Dubai’s Escape Rooms
Dubai has several escape rooms for adults and children and all of them could be a good choice for a hot summer day.Try Brain Game Dubai, NoWayOut Escape Rooms Dubai and Escape the Room Dubai..
Go Indoor Trampolining
Indoor trampolining is another indoor activity for a hot day in Dubai.
Indoor Climbing in Dubai
Indoor climbing is another good indoor activity for Dubai in July. You’ll find indoor climbing for adults or kids at Adventure Zone, The Wall Climbing Gym, and Sky Trail / Climbing Wall, plus more!
Go Ice Skating
Where will you find ice skating in Dubai? Dubai Mall of course.
Swimming and Beaches in Dubai in December
As daytime temperatures hover around 28C, and nighttime temps drop to 14C, the sea in Dubai will be cooler in December. Around 27C or 80F. That’s similar to the temperature of a heated indoor pool in the UK.
The sand may be hot, take shoes to walk to the water’s edge, and of course, good sun protection.
December is probably a good time for a family holiday in Dubai if you’re hoping for days at the beach. A lot depends on the individual and how temperature sensitive they are.
Where to Stay in Dubai in December
If I were looking for a hotel in Dubai in December I would consider Atlantis, The Palm, home to some of the most spectacular attractions in Dubai. You can book an underwater suite or the Regal Family Suites which will accommodate even very large families in style. You can find interconnecting suites with adorable kid-friendly features. Atlantis has all sorts of aquatic attractions such as a full aquarium inside the hotel with water slides that take you right through the tanks, as well as a water park, multiple pools, private beach area and boating. This hotel advertises a Kids’ Club and an outdoor kids’ playground along with indoor play facilities and games. Cots, babysitting and extra kids’ beds are available on request. As these facilities are on-hand, you can choose to utilise them at the best times of day to suit the December weather. Atlantis has some 15 diverse restaurants, many are the work of internationally renowned chefs.
My other best suggestion, if you wish to visit Dubai’s indoor theme parks, would be Lapita Resort
Alternatively, stay near The Burj Khalifa, Dubai Mall and Dubai Aquarium.
For a budget stay in Dubai take a look at the apartments at Golden Sands Hotel Apartments . self catering and self laundry are possible at these resorts. Shopping for food will be OK as I know there is a small supermarket and fast food outlets nearby.
Dubai in December, Sport and Exercise
If you like to keep fit, Dubai’s cooler months will be better for you. You won’t be restricted to exercising at dawn and dusk as you would be in summer. After years of living in the tropics as we have, we can tell you 100% that most activity must be around dawn and dusk in the summer months. The Dubai Marathon (the largest mass participation sporting event in the Middle East) in 2023 is Sunday 12th of February – in winter, and it starts at 6.30am. The good news is, Dubai’s gyms are air-conditioned and climate controlled, making them useable year-round.
Dubai also has an Ironman 70.3 (a half Ironman) dates are to be announced.
December in Dubai, What’s On?
Dubai has special events year-round, but what happens in December? Of course Christmas and New Year’s Eve fall in December, there will be festive events in Dubai in December.
Is Dubai Cheaper in December?
Dubai is expensive in December, as is just about everywhere with the coincidence of school holidays and Christmas.cheaper. If you’re looking for the cheaper months in Dubai investigate the months outside of school holidays, June and the second week of September onwards to the start of the Christmas break.
What to Wear in Dubai in December?
This is personal choice of course, but long sleeves and long pants or a skirt would be my choice in Dubai at any time of year. Some places in Dubai do have a dress code. No skimpy clothing is allowed in Dubai Mall, for instance. So dress for the climate and for cultural politeness.
December in Dubai, Wrap Up
Dubai is a great destination for a holiday, vacation, or as a stopover as you travel from Europe deeper into Asia or even to Australia. It’s a fabulous place to see and we highly recommend it. December is actually a really good time to visit Dubai, although Dubai may be busy, and traffic congestion could be bad. People travel for many reasons and a lot of tourists and visitors do arrive in Dubai in high numbers in December. You can enjoy Dubai in December, marvel at her architecture and enjoy cultural attractions, and outdoor activities. Enjoy Dubai! Looking for more Dubai information? Visit our Dubai travel archive page.
If you'd like to hire a car during your stay, use this car rental comparison tool to find the best deal! We also suggest you take a look at this company to get a quote for all kinds of the more tricky adventure or extended travel insurance. Try Stayz / VRBO for an alternative way to find rentals on homes/apartments/condos in any country!
Related Posts:
Alyson Long
Dubai in july, places to stay in new york city with family, leave a comment cancel reply.
Save my name, email, and website in this browser for the next time I comment.
You can unsubscribe at any time. Please see our Privacy Policy .
COUNTRYPICKERWESELECTEDHEADERMESSAGE
COUNTRYPICKERWESELECTEDMESSAGE click here
Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here
Choose your country and language
- The Americas
- The Middle East
- Asia & South Pacific
- All Inclusive Offers
- Athens Vacations
- Early bird offers
Dubai Vacations
- Last Minute Escapes
- Maldives Vacations
- Milan Vacations
- Upgrades & More
Featured Destinations
Middle east.
- Ras Al Khaimah
Indian Ocean
- Philippines
- South Korea
- South Africa
- All-Inclusive Vacations
- Beach Vacations
- Business Class Vacations
- Family Vacations
- Ultimate Luxury
- Wellness Vacations
- Egypt - Splendours of the Nile
- India - Golden Triangle Tour
- Italy - Milan and Lake Como
- Jordan - Jordan Explorer Tour
- South East Asia
- Sri Lanka - Serendib Explorer
- COVID-19 Hub
- Pay My Balance
- 1-855-358-1505
- Flight + Hotel
Search Holidays
- Manage My Booking
Home to an iconic skyline, miles of pristine beaches, family friendly water and theme parks, and world-class shopping, Dubai is a buzzing city that has something for everyone. A short drive out from the city opens up a world of outdoor and sports activities including helicopter rides, hot air balloons, desert safaris and camping, dhow cruises, kayaking and more.
Book today and enjoy guaranteed savings , low deposits from $199pp, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Simply view our dubai vacation offers below or call our destination specialists on 1-855-358-1505 for further details and to book.
- 30% saving on stay
Four Points by Sheraton Downtown, Dubai, UAE
- 5 nights from $1,045pp
- Classic Room
- Additional Skywards Miles
- All taxes and surcharges included
- Round-trip Emirates economy class flights from Miami (MIA)
Supplements may apply for other departure airports. Valid for new bookings only and subject to availability.
- Complimentary stay for kids
Grand Hyatt Dubai
- 5 nights from $1,445pp
- Breakfast included
- Early booking savings on stay
JW Marriott Marquis, Dubai, UAE
- 5 nights from $1,559pp
- Sea View Room
Hilton Dubai Al Habtoor City, Dubai, UAE
- 5 nights from $1,435pp
- Receive 2 complimentary bronze tickets per stay for La Perle Show
- Complimentary pool and beach access at Habtoor Grand Resort
- Savings on stay
Marriott Resort Palm Jumeirah Dubai, UAE
- 5 nights from $1,549pp
- Complimentary upgrade from Palm Deluxe to Palm Sea View Queen room
15% savings on stay
Hotel riu, dubai, uae.
- 5 nights from $1,649pp
- Double Room Partial Sea View
- All-Inclusive
- Early booking 15% savings on stay
- Breakfast included with a complimentary choice of lunch or dinner
Hilton Dubai Jumeirah Resort, Dubai, UAE
- 5 nights from $1,569pp
- Deluxe Room
20% saving on stay
The palace downtown, dubai, uae.
- 5 nights from $1,879pp
- Deluxe Room Lake View
- Early booking 20% saving on stay
Fairmont The Palm, Dubai, UAE
- 5 nights from $1,929pp
- Fairmont Heritage Room, One King Bed, Balcony
20% savings on stay
Five palm jumeirah, dubai, uae.
- 5 nights from $2,009pp
- Superior Room
Atlantis The Palm, Dubai, UAE
- 5 nights from $3,015p
- Ocean Room King
- Complimentary daily access to Aquaventure Waterpark
- Access to private beach across property
- Access to Atlantis Kids Club & The Zone
- Complimentary access to ShuiQi Fitness Centre
Al Maha, A Luxury Collection Desert Resort & Spa, Dubai, UAE
- 5 nights from $5,305pp
- Bedouin Suite
- Breakfast, lunch and dinner included
- Features a private pool and its own deck with stunning views of the desert
- Complimentary Dune Dining Experience for 2 adults
*Children under 12 are not permitted at the resort
Dubai Beach vacations
Desert Escapes
Dubai Family Vacations
Downtown Dubai
Explore Dubai
Join the emirates vacations community.
Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.
We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.
Why Emirates Vacations?
- Personalised holidays
- Support at every step
- Get more for your money
- Fly Better with Emirates
For more information, please click here
- Recent Hotels 0 You do not have any recently viewed hotels.
- Shortlist 0 Your hotel shortlist is empty!
- Recent Searches You do not have any recent searches
Please refresh this page
This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.
- Greek Islands
- South Africa
- Philippines
- South Korea
- French Polynesia
- Dominican Republic
- Saint Vincent & the Grenadines
- Czech Republic
- Ras Al Khaimah
- Saudi Arabia
- A-Z Destinations & Map
- Escorted Group Tours
- Escorted Tours
- F1 Packages
- Family Holidays
- Golf Holidays
- Multi Centre Holidays
- Rail Holidays
- Short Breaks
- Solo Holidays
- Ultra Luxury Holidays
- Exclusive Deals
Dubai In December 2024: A Guide For Everything To Know!
Social share:.
Dubai in December is a magical experience, offering a splendid blend of sunshine and cool weather. The city comes alive with festive spirit and an array of attractions. You can explore the stunning beaches, go on desert safaris, and enjoy water sports in comfortable temperatures. The annual Dubai Shopping Festival kicks off in December, offering incredible discounts and shopping extravaganzas. The city’s iconic landmarks like the Burj Khalifa and Palm Jumeirah are beautifully adorned with holiday lights, creating a mesmerising spectacle.
It is also a fantastic time for outdoor activities, from golfing at world-class courses to exploring the vibrant Dubai Parks and Resorts. Don’t forget the delectable cuisine – savour international flavours at gourmet restaurants or relish Arabic delicacies at local markets. Dubai in December truly offers an unforgettable vacation experience.
Is December a good time to go to Dubai?
December is an excellent time to visit Dubai, as the weather is comfortably cool and sunny, making it an ideal escape from the harsh winter climates in many other parts of the world. With average temperatures ranging from 18°C to 26°C, it’s perfect for outdoor activities and exploring the city’s iconic landmarks like the Burj Khalifa, Palm Jumeirah, and Dubai Mall. Additionally, December marks the start of Dubai’s festive season, with stunning Christmas and New Year’s decorations adorning the city.
It’s a great time to indulge in world-class shopping at the Dubai Shopping Festival, savour delectable international cuisine at outdoor restaurants, and enjoy various cultural events. Just be aware that hotel rates tend to be higher during this peak tourist season, so booking in advance is advisable for a memorable Dubai experience. However, keep in mind that December is a peak tourist season, so plan ahead to secure accommodations and fully embrace the Dubai experience. Embrace the magic of Dubai’s winter allure and create lasting memories in the heart of the desert.
Dubai Weather in December 2024
Dubai’s weather in December is a delightful escape from the scorching summer heat, offering mild and pleasant conditions for travellers. Daytime temperatures typically range from a comfortable 18°C to a pleasantly warm 26°C, making it perfect for outdoor exploration and activities. Evenings can be slightly cooler, with temperatures dropping to around 14°C, but still very enjoyable.
December is one of the driest months in Dubai, with an average rainfall of just about 10 millimetres, ensuring rain won’t disrupt your plans. The city basks in an abundance of sunshine, boasting an average of 8 to 9 hours of daylight per day. This weather combination makes December an ideal time to visit Dubai, providing a wonderful opportunity to experience its iconic attractions and outdoor offerings while avoiding the extreme heat of summer.
What to Wear in Dubai in December 2024
In December, Dubai’s weather is comfortably cool, making it essential to pack a mix of lightweight, breathable clothing and slightly warmer options for cooler evenings. During the day, opt for light, airy clothing such as shorts, skirts, and short-sleeved shirts to stay comfortable in the mild temperatures that can range from 18°C to 26°C. Don’t forget to bring swimwear for beach visits or hotel pool lounging. For evenings and cooler moments, pack a few long-sleeved shirts, a light sweater, or a jacket.
Since Dubai is a conservative city, it’s advisable to dress modestly, especially when visiting religious sites or public places. Women should carry a scarf to cover their shoulders when needed. Lastly, comfortable walking shoes are a must for exploring the city’s attractions, and sun protection items like sunglasses, sunscreen, and a wide-brimmed hat are essential due to the bright sunshine.
Visitor Arrivals: Is Dubai Crowded During December?
Dubai experiences a surge in tourist activity during December, making it relatively crowded. The pleasant winter weather, numerous festivals, and holiday season attract visitors from around the world. Popular attractions like the Burj Khalifa, Dubai Mall, and the Palm Jumeirah are particularly crowded during this time. Moreover, Dubai hosts various events, including the Dubai Shopping Festival and New Year’s Eve celebrations, which draw massive crowds.
Hotels and resorts often get fully booked, and it’s advisable to make reservations well in advance. While the crowds can lead to longer wait times at tourist spots, shopping centres, and restaurants, it also creates a festive atmosphere and opportunities to join in the holiday spirit. Despite the crowds, December remains a popular time to visit Dubai due to its delightful blend of cultural experiences, entertainment, and beautiful weather.
Average Costs of a Trip to Dubai in December
The average cost of a trip to Dubai in December can vary widely depending on your preferences. Airfare from major international hubs ranges from £700 to £1,500 for a round-trip ticket. Hotels and resorts offer a wide range of options, from budget to luxury, with prices starting at around £70 per night and going up to £500 or more for high-end accommodations. Transfers within the city are reasonably priced, with taxis and rideshare services readily available and costing approximately £1.50 to £3 per kilometre. Overall, a mid-range trip for a week could cost around £1,500 to £2,500 per person, excluding activities and dining.
What to Do in Dubai in December
The city’s cultural side can be explored through visits to the Dubai Opera, Dubai Museum, and the historic Al Fahidi neighbourhood. Dining options are abundant, with a variety of international cuisines to savour. Additionally, Dubai’s festive spirit during December culminates in spectacular New Year’s Eve celebrations and fireworks, creating a memorable end to the year.
Where to Stay in Dubai in December?
Dubai offers a wide range of accommodation options to suit various preferences and budgets. For those seeking luxury and opulence, the iconic Burj Al Arab or the ultra-modern Atlantis, The Palm, provide unparalleled extravagance and stunning waterfront views. The Downtown Dubai area, home to the Burj Khalifa and Dubai Mall, offers numerous upscale hotels and convenient access to major attractions. Jumeirah Beach and the Palm Jumeirah boast luxurious beachfront resorts, perfect for relaxation and water activities. Travellers on a more modest budget can find comfortable and affordable options in neighbourhoods like Deira and Al Barsha. Additionally, Dubai’s diverse hotel scene caters to business travellers, families, and couples, ensuring a comfortable and memorable stay amidst the city’s vibrant December atmosphere.
Where to travel in Dubai in December?
Dubai in December offers a plethora of exciting destinations to explore. Start with the iconic Burj Khalifa, the world’s tallest tower, and enjoy panoramic views from the observation deck. Stroll along the vibrant Dubai Marina Promenade or relax on the pristine Jumeirah Beach. Explore the historic Al Fahidi neighbourhood to discover Dubai’s cultural heritage at the Dubai Museum and Al Fahidi Fort.
For a taste of extravagance, visit the Palm Jumeirah and Atlantis, The Palm resort, known for its stunning underwater aquarium. Dubai’s desert dunes are perfect for thrilling desert safaris, complete with dune bashing and Bedouin-style dinners.
Don’t miss the Dubai Shopping Festival, offering incredible discounts, or the mesmerising Dubai Fountain Show at the base of the Burj Khalifa. Finally, ring in the New Year with spectacular fireworks and celebrations, making December a fantastic time to experience Dubai’s unique blend of modernity and tradition.
What to Eat in Dubai in December 2024?
Dubai offers a delectable array of culinary delights that cater to all tastes. Visitors can savour a wide variety of dishes ranging from traditional to international flavours. Freshly caught seafood is a popular choice, often prepared in diverse and delicious ways. Food festivals and street vendors offer tantalising snacks and treats, while upscale restaurants provide gourmet dining experiences with innovative fusion dishes. Dubai’s multicultural influences are evident in its diverse menu options, allowing diners to indulge in a world of flavours. Additionally, the pleasant weather during December makes it an ideal time to dine outdoors, enjoying al fresco meals and stunning views of the city’s skyline or waterfronts.
Best Tips for Visiting Dubai in December 2024
Visiting Dubai in December can be a fantastic experience due to the pleasant weather and festive atmosphere. By following these tips, you can have a memorable and enjoyable visit to Dubai in December, taking advantage of the pleasant weather and the city’s festive spirit. Here are some tips to make the most of your trip.
- December is a peak tourist season in Dubai, so book your flights, accommodation, and major attractions in advance to secure the best deals and avoid disappointment.
- While Dubai is generally liberal, it’s respectful to dress modestly, especially when visiting cultural sites. However, swimwear is acceptable at the beach or by the pool.
- Despite the cooler weather, Dubai can still be dry, so drink plenty of water to stay hydrated, especially if you’re outdoors.
- Enjoy the pleasant temperatures by planning outdoor activities like desert safaris, beach days, or walking tours.
- Visit traditional souks (markets) like the Gold Souk and Spice Souk for unique shopping experiences.
- Don’t miss the Dubai Shopping Festival and New Year’s Eve celebrations for a memorable experience.
- Familiarise yourself with local customs and laws, such as not consuming alcohol in public areas during the day.
- Dubai has an efficient metro system and plenty of taxis. Public transportation is a convenient and cost-effective way to get around.
- Carry local currency (UAE Dirhams) for small purchases, but credit cards are widely accepted.
- English is widely spoken, but learning a few basic Arabic phrases can be appreciated by locals.
- Consider purchasing travel insurance to cover unexpected events.
Read Also: Vietnam in December | Bali in December | Maldives in December
Best time to visit Dubai | What to eat in Dubai | All-inclusive hotels in Dubai
Thailand in December
FAQs of Dubai on December
Dubai experiences a shift from scorching summer heat to milder, more comfortable temperatures. While it’s not as hot as the peak summer months, Dubai is still relatively warm in December. Daytime temperatures typically range from 20°C to 30°C, making it pleasantly warm for outdoor activities. Evenings and nights are cooler, averaging around 15°C to 20°C. It’s an ideal time to explore the city, enjoy outdoor attractions, and dine al fresco. The weather in December is generally sunny and dry, making it a popular month for tourists seeking a winter escape.
In December, the sunset time in Dubai varies slightly throughout the month due to the Earth’s axial tilt. Generally, during early December, the sun sets around 5:30 to 5:45 PM local time. As the month progresses, the days become slightly shorter, and by late December, the sunset occurs around 5:20 to 5:30 PM. Keep in mind that this is an approximation, and sunset times can vary slightly from day to day. It’s advisable to check a reliable source or a local app for the exact sunset time during your visit to Dubai in December, especially if you have specific plans around sunset.
Recommended Posts
Best in Travel: Best Places to go on Holiday in 2024
As the weather starts warming up and summer is fast approaching, it’s time to start thinking about the best places...
13 Top Warmest July Destinations: Sun, Sand, and Adventure Await!
Many destinations around the world can offer you a great and memorable experience during July. It is an ideal time...
32 Unbeatable Things To Do In India That All Travellers Must Try In 2024.
India’s diverse landscapes offer a spectrum of experiences from serene backwaters to bustling bazaars. Travellers can explore ancient temples and...
Leave a Comment Cancel reply
Your email address will not be published. Required fields are marked *
Save my name, email, and website in this browser for the next time I comment.
- Affordable Luxury Travel Recommends
- Thailand Travel Guide
- Travel News
UK Public Bank Holidays & School Holidays 2024, 2025 & 2026
July holiday destinations: the 14 best places to go, holiday destinations for families: the 14 best places to go, top bioluminescent beaches: a guide to the world’s radiant wonders, where is hot in april in europe the 10 best places to go.
WHY BOOK WITH US
PERSONALIZED ITINERARIES
PRICE GUARANTEE
5-STAR REVIEWS
TRUST & EXPERIENCE
Subscribe to our newsletters to see the latest deals
Affordable Luxury Travel, based in London’s Fitzrovia, is the latest addition to the successful and long established Moresand Ltd.
IMPORTANT LINKS
QUICK LINKS
Our Key Industry Partners
© 2024 Affordable Luxury Travel. All rights reserved. A trading division of Moresand Ltd
Welcome Back!
Login to your account below
Remember Me
Retrieve your password
Please enter your username or email address to reset your password.
Dubai’s Top 10 Destinations in December 2024
Numerous tourists from all over the world likely consider Dubai to be among the most well-liked and desirable vacation spots. Dubai has gained popularity as a tourist destination due to its quick expansion. Dubai checks all the boxes in terms of being the ideal vacation spot.
Dubai is at its best in December, with many fantastic entertainment options and man-made wonders to explore. To assist you in making the finest travel arrangements for your next vacation during the winter in Dubai, we have created a travel guide with the top 10 destinations.
Table of Contents
December Weather in Dubai
In December, Dubai’s weather is hot, with temperatures ranging from 21°C to 26°C. The weather in Dubai during December is almost always sunny and pleasant for hanging out outside and exploring the city. Before you visit Dubai, we recommend that you review the 14-day weather forecast for Dubai.
A moderate high of 25.3°C (77.5°F) is recorded in December in Dubai, while the average low is 20.9°C (69.6°F) in December. There is 56% of relative humidity on average in Dubai during the month of December.
During December Dubai sees 4mm of precipitation collected in 3.1 days. A typical year in Dubai sees 22.8 days of rain with 40mm of precipitation.
List of the Top 10 Places to Visit in Dubai in December:
1. palm jumeirah.
Palm Jumeirah, a tree-shaped artificial archipelago, is the smallest of the three planned islands in Dubai. From above, Palm Jumeirah looks like a palm tree. This island is known for its opulent hotels, residential buildings, and upscale dining.
Make time to visit Palm Jumeirah for a range of outdoor pursuits and a stunning sunset view. Look into the island’s vibrant nightlife, and enjoy beach clubs with spas and energetic DJ evenings. It is one of Dubai’s most breathtaking locations to visit in the winter.
2. Dubai Desert Conservation Reserve
A brief city break is strongly advised, even if you’re only in Dubai for a city tour. There are a few must-see natural tourist sites in Dubai. A renowned wildlife attraction in the UAE, Dubai Desert Conservation Reserve is home to various indigenous wildlife.
You can enter one of the four zones if you take part in a short day excursion that is led by a guide or is organized by a travel operator. If you choose to stay in their lavish wildlife lodge, the other three are accessible to resort guests.
3. Global Village
For the first time, the doors of Global Village will open their doors to a global audience. It is regarded as one of Dubai’s most anticipated family entertainment events. Travellers and tourists from around the world congregate in this global metropolis to take advantage of the many retail and leisure possibilities.
The worldwide village is a well-liked platform for nations to promote themselves and for others to discover more about them. Typically, Dubai experiences good weather when hosting the event. It is in addition to the possibility of sampling a variety of culinary pleasures in one place.
- 8 Days Dubai & Abu Dhabi Package
- Dubai Travel Itinerary 6 Days
- 5 Days Dubai Tour Package
- Dubai Tour 3 Nights 4 Days
- More Itinerary for Dubai Click here…
4. Ski Dubai
Ski Dubai is the world’s first and biggest indoor snow park and a five-slope indoor ski resort with varied lengths, difficulty, and slopes. All fun activities are available at the snow park, including a chairlift ride, tube slides, a ball rolling down, a zipline, and a 10-foot jumping ramp.
Tourists should not miss the Penguin March, a spectacular parade of snow penguins that occurs daily. On-site cafés and cafeterias are available at Ski Dubai, and there is a shopping mall where you can purchase the newest winter apparel and sporting goods.
5. Jumeirah Beach
One of Dubai’s busiest and most frequented public beaches is Jumeirah Beach. The city’s beautiful sandy beach spans down the coastline, surrounded by several sizable resorts and hotels. Jumeirah Beach is called for the neighbourhood of Jumeirah from which the beach extends.
Jumeirah Beach’s breathtaking vistas offer a much-needed break from stress. Visitors will like anything here as lounging offers a comprehensive entertainment facility. There are several restaurants and commercial areas near the seashore. While others unwind on the sand and think about the deep blue sea, sun-lovers may obtain their tans.
6. Bastakiya
The Al Fahidi Historic District (sometimes called Al Bastakia or Bastakiya) is a great place to see the other side of Dubai. You can enter one of the four zones if you take part in a short day excursion that is led by a guide or is organized by a travel operator. If you choose to stay in their lavish wildlife lodge, the other three are accessible to resort guests.
A fascinating view of Arabian culture is offered by this place. You may discover the architectural marvel of the old buildings, dark wooden doors, wind towers, and white mosques here, making it a worthwhile destination.
7. Dubai Opera
The city of Dubai has no shortage of entertainment options, but one well-liked tourist destination that shouldn’t be missed is the Dubai Opera, located in the heart of the city. Another restaurant offers mouthwatering dishes on its rooftop.
It is one of the best locations to go for music entertainment on a night out in Dubai, where you can discover muses in their opera performances, ballet performances, comedy acts, concerts, and even plays on classical instruments.
8. Dubai Museum
Al Fahidi Fort, the city’s oldest building, is perhaps one of Dubai’s most popular tourist attractions . The Dubai Museum is ideally housed on the property if you love history. You may read about Dubai’s development from a small, abandoned fishing community to one of the most technologically advanced nations here.
Pictures and artefacts within depict Bedouin life and the significance of the sea before the discovery of oil. Additionally, there are several ancient artefacts on display in the Dubai Museum. You may take your kids here, or even grandparents who are fascinated by Arabian nomadic culture.
9. Deira Souk
Although Dubai has many souks (markets), Deira is a favourite among tourists. It is reported to have been founded in the 1830s and is conveniently positioned next to Dubai Creek. If you go, you can still see the wooden arches and original architectural design of the market.
But wait, we’ll tell you what the greatest part is—and perhaps the main reason you came here in the first place—is to see the many types of gold exhibited in the storefront windows and, even better, to buy them—even though you’ll end yourself wishing you had them all!
10. Dubai Aquarium
Visit one of the biggest and most stunning aquariums in the world, which is home to more than 33,000 aquatic creatures, including the largest population of sand tiger sharks on the planet. Stroll through a 48-meter tunnel as the aquarium is on all sides of you, with stingrays and sand tiger sharks swimming above you in a real fish-eye perspective.
While you’re here, you may also go cage snorkelling or scuba diving. Other options include taking a glass-bottom boat trip, getting a mermaid makeover, dousing yourself in the water while snorkelling, or donning an oxygen tank and swimming with sharks. The complex’s zoo contains a great assortment of animals.
Things to Do in Dubai in December:
There is no shortage of things to do in Dubai when visiting this Arab metropolis. There are several leisure options available to keep you occupied all day. You can see the Burj Khalifa in Dubai from every part of the city if you’re there.
A fantastic approach to discovering the cityscape is to take the Dhow Cruise. In an original wooden Arab Dhow that embodies the distinctive Bedouin character, the cruise cruises down Dubai Creek. When it comes to things to do in Dubai, one of the most popular is skydiving, especially for thrill-seekers.
Events in Dubai in December:
Several occasions happen just once a year, in this particular month. The UAE National Day Festival, the Dubai Shopping Festival, and the International Film Festival of Dubai are a few of them. You may also partake in deep-sea diving, skydiving, camel rides, hot air balloon excursions, and other unique activities. The tourists may accomplish all of this without concerns due to the ideal weather in December.
In Conclusion
If you do not travel to Dubai during the winter, you will lose out on numerous unique outdoor activities. Starting your plans early can help you enjoy the greatest vacation possible when visiting Dubai in December. It will enable you to reduce spending without paying more when winter approaches.
To learn more about Dubai:
- Top 10 Famous Reasons to Visit Dubai
- Dubai Tourist Places Visit in January 2023
- Famous Destinations in Dubai in February 2023
- Best Dubai Places to Visit March 2023
- 10 Famous Destinations to Visit Dubai in April 2023
- 10 Famous Places to See In Dubai During August 2023
About The Author
Tusk Travel Team
Related posts.
UAE offer 5-Year Tourist Visa for All Nationalities
20 Best Places to Visit in South India in December 2024
Leave a comment cancel reply.
Your email address will not be published. Required fields are marked *
Save my name, email, and website in this browser for the next time I comment.
You can unsubscribe at any time. Please see our Privacy Policy .
COUNTRYPICKERWESELECTEDHEADERMESSAGE
COUNTRYPICKERWESELECTEDMESSAGE click here
Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here
Choose your country and language
- The Americas
- The Middle East
- Asia & South Pacific
- Festive Offers
- Holidays 2024
Dubai Holiday Offers
- Last Minute Escapes
- Atlantis The Palm Offers
- Ras Al Khaimah Holidays
Middle East
- Ras Al Khaimah
Indian Ocean
- All-inclusive Holidays
- Beach Holidays
- Business Class Holidays
- Family Holidays
- Luxury Holidays
- Winter Sun Holidays
- London Heathrow
- London Gatwick
- London Stansted
- Additional Services
- In-Resort Service
- Opening Hours
- Pay My Balance
- 020 8972 8951
- Flight + Hotel
Search Holidays
- Manage My Booking
- London - All Airports
- London Gatwick (LGW)
- London Heathrow (LHR)
- London Stansted (STN)
- Birmingham (BHX)
- Manchester (MAN)
- Newcastle (NCL)
- Glasgow (GLA)
- Edinburgh (EDI)
Dubai is home to a world of wonders for those adventurous to discover it. With something for every kind of traveller, Dubai is perfect for your next holiday. For those looking for a relaxing retreat, you will find some of the world’s best resorts, whether on the iconic Palm Jumeirah , bustling Downtown Dubai , the world-famous Jumeirah Beach or enjoying cafe culture along The Walk . Thrill-seekers will be in their element, with a plethora of high-octane theme parks and water parks, such as Dubai Parks and Resorts, Aquaventure Waterpark, IMG Worlds of Adventure, Wild Wadi Waterpark and so much more. It doesn’t stop there though; you could be racing down the slopes of Ski Dubai , reaching the dizzying heights of the world’s tallest building at the Burj Khalifa or soaring high above Dubai on a Seawings Seaplane Tour . Experience this and so much more on your next getaway. Find out more about a tantalising holiday in Dubai here .
Beyond that, Dubai is also home to the world’s largest shopping mall, The Dubai Mall , with more than 1,000 designer stores and boutiques where you’re guaranteed to find presents for all the family (or yourself). Aside from the largest mall in the world, Dubai also has a variety of bustling, traditional souks and shopping centres to cater for everyone’s shopping needs.
View our Dubai holiday offers below and book today to enjoy guaranteed savings, low deposits from £100, complimentary meal and room upgrades and many more extras to make your next Dubai holiday truly special. Book online or call us for more information on 020 8972 8951 .
- Three complimentary sessions at Atlantis Explorers Club and The Zone
Atlantis, The Palm, Dubai
- 5 nights from £2,049pp
- Ocean Room Queen
- Travel on selected dates from 24 to 30 October 2024
- Return Emirates flights from London Gatwick
- Price based on 2 adults and 2 children
Supplements may apply for other departure airports. Valid for new bookings only and subject to availability.
- Kids Eat and Stay Free
The Ritz-Carlton Dubai
- 5 nights from £1,629pp
- Half Board Dine Around
- Deluxe Room
- Return Emirates flights from London Heathrow
- Unlimited access to Wild Wadi Waterpark
Jumeirah Beach Hotel, Dubai
- 5 nights from £1,929pp
- Deluxe Room Ocean with Balcony
- Return Emirates flights from Manchester
- Complimentary Half Board upgrade
Anantara The Palm Dubai Resort
- 5 nights from £1,195pp
- Deluxe Lagoon View Room
- Travel on selected dates from 01 to 30 October 2024
- Return Emirates flights from Birmingham
- Access to Jungle Bay waterpark
The Westin Dubai Mina Seyahi Beach Resort & Marina
- 5 nights from £1,219pp
- Deluxe Skyline
- Return Emirates flights from Glasgow
- Kids Eat Free
Lapita, Dubai Parks and Resorts, Autograph Collection
- 5 nights from £939pp
- Half Board Plus
- Deluxe Twin Room Resort View with Park access
- Return Emirates flights from Newcastle
Dubai Family Holidays
Luxury Dubai
Desert Escapes
Downtown Dubai
Explore Dubai
All-inclusive Dubai
Dubai Beach Holidays
Dubai City Breaks
Join the emirates holidays community.
Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.
We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.
Why Emirates Holidays?
- Personalised holidays
- Support at every step
- Get more for your money
- Fly Better with Emirates
- Enjoy rewards with Emirates Skywards
For more information, please click here
- Recent Hotels 0 You do not have any recently viewed hotels.
- Shortlist 0 Your hotel shortlist is empty!
- Recent Searches You do not have any recent searches
Please refresh this page
This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.
Women Travel Abroad
December 16-22, 2023.
Dubai, the ‘City of Gold’, is one of the most culturally diverse and over-the-top cities in the world. From record-breaking architecture and stunning coastlines to award-winning cuisine and exclusive attractions, it’s easy to see why this is the perfect place to experience a mix of cosmopolitan city with local culture. Join WTA to immerse yourself into the true Dubai experience: discover the city skyline by yacht, unleash your senses amidst the Old Souk spice market, and create unforgettable memories adventuring through the Arabian Desert. What are you waiting for?!
- Activity Level
DAY 1 – December 16 – Arrive at Dubai International Airport (DXB), and private transportation will bring you to your accommodations for the week. After settling in, get to know your fellow WTA travelers at the welcome dinner!
DAY 2 – December 17 – After a morning exploring the Jumeirah City Market, your group will embark on an unforgettable journey across the Dubai Desert on an Arabian Nights Desert tour. You will encounter the famously red sand dunes and experience the hospitality of a Bedouin desert camp. Here, you can partake in many interactive cultural activities including camel rides and belly dancing shows, and enjoy a memorable feast of local cuisines.
DAY 3 – December 18 – FREE Day. Enjoy a day of shopping, take a tour of the city, visit a museum, or take advantage of the gorgeous weather by relaxing and having a beach day.
DAY 4 – December 19 – Today, will enjoy Dubai’s skyline from the comfort of a private yacht. We will cruise and relax as we sail along the marina and Arabian Gulf waters. Glide by the Burj Al Arab, Atlantis – The Palm, and opt to swim in the marina lagoon.
DAY 5 – December 20 – FREE Day. Enjoy a day of shopping, take a tour of the city, visit a museum, or take advantage of the gorgeous weather by relaxing and having a beach day.
DAY 6 – December 21 – Get ready to be amazed on today’s Dubai City and Old Souk tour. Discover the landmarks of Dubai old and new. Tucked into Dubai’s Deira district just north of Dubai Creek, the Dubai Spice Souk offers some of the city’s most rewarding shopping. Here, covered alleyways brim with stalls that sell all manner of Arabian and Asian spices, herbs, and delicacies, making the souk ideal for souvenir hunters and anyone hoping to get a sense of old Dubai. After the tour, you will head to an Arabian Tea House for an authentic tea experience and some Emirati cuisine. Tonight, we will toast beachside to a wonderful week in paradise.
DAY 7 – December 22 – A private transfer will take you back to Dubai International Airport (DXB) for your connecting flight to the US.
PRICING: $4,850
WHAT’S INCLUDED:
- 7 days & 6 nights’ accommodations
- Single occupancy, luxury hotel
- Airport transfer
- Arabian Nights Desert Tour
- Private Souk Tour
- Private Yacht Tour
- FREE DAYS to explore
- Daily breakfast
- Daily group lunch (excluding FREE DAYS)
- Daily group dinner
- COVID antigen testing for USA re-entry, if applicable
WHAT’S NOT INCLUDED
- Roundtrip airfare from US to Dubai Airport (DXB)
- Travel insurance
- Items of personal nature
- Meals not listed above
- Optional excursions and tours not listed above
- Gratuities and tips for personal services
TRAVEL INSURANCE:
- Travel Guard
- Allianz Travel Insurance
ADDITIONAL INFORMATION:
- Traveler must make a NONREFUNDABLE deposit payment of $400 at time of registration to secure her spot.
- Monthly minimum payment of $400 is required on the first of every month until paid in full to keep your reservations current.
- Final payment must be made 90 days before the trip date.
- A 50% refund can be requested prior to 6 months before the trip start date found in your invoice.
- No refunds for cancellations within 6 months of the trip date found in your invoice.
- A $250 penalty will be charged for any outstanding balance after the final payment date found in your invoice.
- For inquiries, contact wtaadmin@ womentravelabroad.com
NEVER MISS A TRIP
Subscribe to our newsletter.
You have Successfully Subscribed!
I know you want to go but this trip is sold out. Click here to see our open trips. We would love to have you join us.
Activity Levels
If your vacation is your time to relax, and you're looking for a trip with minimal physical activity, then choose one of these packages. Explore via guided city tours and motor coaches, plus some light walking on flat ground, with plenty of time to unwind.
Recreational
These packages are a great fit if you seek a blend of light activities as well as leisure time. Throw on your favorite comfortable shoes and enjoy guided walking tours on easy terrain, as well as coach touring.
Not the sort to watch the world go by? These packages are perfect if you enjoy getting out in the world and being on-the-go! Enjoy longer walking tours and days full of fun activities punctuated with time to rest.
Want to see it all? If you enjoy exploring the world on foot, are in good physical condition, and don't mind some uneven terrain or steps, then these packages are for you! Enjoy exciting nature hikes, fast-paced city tours, and action-packed fun!
Dubai’s ICD reports Dh60.8 billion net profits on Dh310 billion revenue
By Saifur Rahman
Investment Corporation of Dubai, an investment arm of the Government of Dubai, reported a 68 percent jump in net profits to a new record of Dh60.8 billion on Dh310.2 billion in revenue for the year ended 31 December 2023.
This growth has been backed with strong growth reported by the Emirates Group that includes the world’s largest international passenger carrier Emirates Airline and its ground handling and ticketing arm Dubai National Air Travel Agency (Dnata) that recently reported a 71 percent jump in net profits exceeding Dh18.7 billion (US$5.1 billion) in 2023-24 financial year ending March 31 2024, compared to Dh11 billion (US$3 billion) recorded the previous year. This is a new profit record for Emirates Group.
Emirates Group revenue increased 15 percent to Dh137.3 billion (US$7.4 billion) compared to Dh119.8bn (US$32.6bn) in 2022-23 financial year, driven by strong customer demand across its businesses. At the end of the financial year, Emirates Group had a strong cash balance of Dh47.1 billion (US$12.4 billion). Emirates Group declared a Dh4 billion (US$1.1 billion dividend to its shareholder – the Government of Dubai through Investment Corporation of Dubai (ICD).
Sheikh Ahmed bin Saeed Al Maktoum, Chairman and Chief Executive, Emirates airline and Group , said, “Throughout the year, we saw high demand for air transport and travel related services around the world, and because we were able to move quickly to deliver what customers want, we achieved tremendous results. We are reaping the benefit of years of non-stop investments in our products and services, in building strong partnerships, and in the capabilities of our talented people.”
“Both Emirates and Dnata have forged successful business models leveraging Dubai’s unique advantages, in turn generating enormous value for Dubai and the communities they serve around the world. The Group’s excellent financial standing today places us in a strong position for future growth and success. It enables us to invest to deliver even better products, services, and more value to our customers and stakeholders.”
The ICD Group’s total assets reached a new record of Dh1.32 trillion, up 12 per cent or Dh145.3 billion, and liabilities Dh1.01 tri llion, up 11 per cent, primarily pushed by the 16 per cent asset growth in banking. Non-banking operations grew their assets up by 5 per cent whilst reducing their indebtedness. The Group’s share of Equity increased by Dh21.4 billion, rising to a record of Dh237.9 billion.
“Economic growth in the UAE is broad based, led by robust activity in the tourism, construction, manufacturing, and financial services sectors. Foreign demand for real estate, increased bilateral and multilateral ties, and the UAE’s safe haven status continue to drive rapid growth in housing prices and an increase in rents, while adding to ample domestic liquidity,” according to Ali Al Eyd, Head of the International Monetary Fund team that visited the UAE two weeks ago.
“Impacts from geopolitical tensions have been contained thus far, while the authorities delivered a rapid response to address the recent flooding episode. Overall real GDP is projected to grow by around 4.0 percent in 2024, and average inflation is expected to remain contained close to 2 percent.”
Its revenue of Dh310.2 billion is 16 percent or Dh42.8 billion up from 2022, driven primarily by significantly higher passenger traffic in transportation as well as the asset growth and higher interest rates in banking and financial services sectors. The net profit attributable to the equity holder was Dh50.3 billion, up 69 per cent.
A number of Dubai Government-owned businesses are part of ICD, including Emirates Airline and Group, Emirates NBD, Ethra Dubai, Wasl Properties, among others.
Oil & Gas revenues declined as global oil prices retreated from their 2022 peak. Overall revenues grew faster than operational costs, boosting margins.
“The Group reported a record Net Profit of Dh60.8 billion, up 68 per cent with an increase of Dh24.6 billion predominantly from transportation, up 119 per cent, and banking and financial services, up 69 per cent, lifting their net profit to new highs. The strong momentum in real estate and hospitality sectors contributed to the record profits posted by many businesses in the Group. Oil and gas and aluminium production generated good profits, albeit lower than last year,” it said in a statement.
Mohammed Ibrahim Al Shaibani, Managing Director of ICD, said, ”ICD announced today its best-ever performance, a truly exceptional achievement as the Group posted, for the third consecutive year, tremendous growth and reached an unparalleled level of revenue and profitability, primarily driven by airlines and ban king sectors .
“The strong regional economic momentum and increased competitiveness of our businesses created an effect of scale resulting in higher margins and performance of our portfolio companies operating in the transportation, banking and financial services, and other segments.
“Overall, the improved liquidity, asset quality, and the reduced leverage in non-banking operations further strengthened the Group’s financial position; assets and equity reached new records.
“As we continue to pursue growth and diversification, I am confident our businesses’ resilience and strength as well as ICD’s investment strategy will help us fulfil our mandate to maximise value for Dubai.
ICD was established in May 2006 by Decree (11) of 2006 and mandated with the consolidation and management of the Government of Dubai’s portfolio of commercial companies and investments. ICD also provides financial and strategic oversight to portfolio companies to maximise value for the long-term benefit of the Emirate of Dubai.
ICD’s portfolio comprises some of Dubai’s most recognised companies and represents a cross-section of vital economic sectors that the Government of Dubai has deemed strategic for the continued development and growth of the Emirate of Dubai.
Also published on Medium .
ADVERTISEMENT
Moroccan cyber startup defendis emerges with ai-powered threat intelligence platform, deadly bus crash in southwest pakistan, related posts, climatemusic project harmonizes science and song.
CPA Australia: Employment plans and export outlook for Taiwan small businesses hit record high
Etiqa Insurance Singapore Introduces Tiq CashSaver, A New Endowment Plan to Secure One’s Financial Future
Celebrate The Summer Season: Hoiana Resort & Golf Launches Vibrant Summer Vibes Campaign
Mastercard unveils effort to simplify transfers.
Money20/20 Europe Agenda Considers Signal Vs Noise: Differentiating Between Visionary Breakthroughs and Hot Air
- India Politics
- SocialKrowd News
- MarketersMEDIA
- Mobile Home
- Advertise on Arabian Post
- AP on MSN News
- HDN on opensea.io
- Google News
- Submit Press Release
- System Status
- Buzz | Arabian Post
- Climate Action
- Crypto News
- Featured Blogs
- Faking Daily
- Top Gadgets
- The Netizen Report
- Humour & Satire
- Even More News
- Sophie Annaston
- Edatata Narayanan
- Islamic Coin x Haqq
- Newswire by MarketersMEDIA
- Satyen Raja
- Ole S. Hansen
- Ben Beckett
- Hani Abuagla
- James M Dorsey
- Kalyani Shankar
- K Raveendran
- Matein Khalid
- Nantoo Banerjee
- Nigel Green
- Sushil Kutty
- Saifur Rahman
- Nitten Nair
- 1arabia.com
- Gulf Property – Pan Asian Group
- India Press Agency
- Social Krowd – Dubai
- StockieDokie!
- The Hyphen Blog
- Latest News
- Emergencies
- Ask the Law
- GN Fun Drive
- Visa+Immigration
- Phone+Internet
- Reader Queries
- Safety+Security
- Banking & Insurance
- Dubai Airshow
- Corporate Tax
- Top Destinations
- Corporate News
- Electronics
- Home and Kitchen
- Consumables
- Saving and Investment
- Budget Living
- Expert Columns
- Community Tips
- Cryptocurrency
- Cooking and Cuisines
- Guide to Cooking
- Art & People
- Friday Partner
- Daily Crossword
- Word Search
- Philippines
- Australia-New Zealand
- Corrections
- Special Reports
- Pregnancy & Baby
- Learning & Play
- Child Health
- For Mums & Dads
- UAE Success Stories
- Live the Luxury
- Culture and History
- Staying Connected
- Entertainment
- Live Scores
- Point Table
- Top Scorers
- Photos & Videos
- Course Reviews
- Learn to Play
- South Indian
- Arab Celebs
- Health+Fitness
- Gitex Global 2023
- Best Of Bollywood
- Special Features
- Investing in the Future
- Know Plan Go
- Gratuity Calculator
- Notifications
- Prayer Times
UAE public holidays for 2025 announced
Uae government.
- Environment
Holidays are applicable to both public and private sectors in the country
Dubai: The UAE Cabinet has issued resolution No. 27 of 2024 concerning public holidays for both the public and private sectors in 2025, according to the official gazette.
The resolution regarding the 2025 official holidays was issued after reviewing the Constitution; Federal Law No. 11 of 2017 on granting the Cabinet certain competencies; Federal Law No. 33 of 2021 on the Regulation of Labour Relations and its amendments; Federal Law No. 49 of 2022 on Human Resources in the Federal Government; and Cabinet Resolution No. 27 of 2019 concerning Public Holidays in the state and its amendments.
Click here to get exclusive content with Gulf News WhatsApp channel
According to Article No.1 of the resolution, the public and private sectors are entitled to a one-day holiday on January 1, 2025, to celebrate the New Year.
The public and private sectors will enjoy a three-day holiday from Shawwal 1-3, based on moonsighting. If the holy month of Ramadan completes 30 days, the 30th day of Ramadan shall be an official holiday added to the Eid Al Fitr holidays.
The official dates will be confirmed closer to the events based on moonsighting for corresponding Islamic calendar dates.
The calendar includes Dhu Al Hijjah 9 for the Arafa Day, and Dhu Al Hijjah 10 to 12 to mark Eid Al Adha, while Muharram 1 is a holiday to mark the Islamic New Year holiday.
The UAE public holidays calendar also includes Rabi Al Awwal 12, which marks the Prophet Mohammed’s (PBUH) birthday, and December 2 and 3, 2025 as the 54th UAE National Day holiday.
As per article No.2 on transferring public holidays, with the exception of Eid holidays, any of the official holidays mentioned in article No.1 of the Cabinet resolution may be carried over by a Cabinet decision to the beginning or end of the week.
Article No. 3 stipulates that a public holiday may not be carried forward if it falls on another public holiday or a weekend.
As per article No. 4 on approval of other public holidays, local governments may approve any other official holidays not mentioned in this resolution for their government departments and institutions on special occasions or for any other reason.
Cabinet Resolution No. 27 of 2019 is hereby repealed, and any provision that contradicts or conflicts with the provisions of resolution No.27 of 2024.
This resolution shall be published in the official gazette and will come into effect from January 1, 2025.
More From Government
UAE President participates in China-Arab States Forum
UAE calls for ceasefire, humanitarian access in Gaza
UAE President arrives in China for two-day state visit
Watch: UAE President meets Emirati students in Korea
Indian man wins $1 million in Dubai Duty Free draw
New report uncovers podcasting challenges in Arab world
17 archaeological sites in Dubai to know
Abu Dhabi Police deny rumour of ‘50% discount on fines’
Why investors are rushing to secure second citizenship, fertiglobe has plans of its own once adnoc deal is done, we're only human, says mcilroy, un warns of disease risk in papua new guinea.
Get Breaking News Alerts From Gulf News
We’ll send you latest news updates through the day. You can manage them any time by clicking on the notification icon.
Why Traveling Around Africa Is Difficult for Africans
I was scrolling on social media when a post caught my eye. Green Ranger Safaris , a travel company I'd never heard of, was organizing a road trip through seven African countries. This trip would start in Nairobi, Kenya, then head down into Tanzania, Malawi, Zambia, Zimbabwe, Namibia, and Botswana. The pricing was reasonable, so I paid a deposit, brushing aside concerns about both spending weeks on end with a group of strangers and the slight chance that the trip might have been an excellently worded scam.
A few months later, in August, I was on a truck with those strangers. It was late in the evening, and we swept through the Kalahari Desert in northern Botswana, the sun in the sky a flaming orb, the only visible life on the sand of the desert being the shrubs, the wild horses, and the herds of elephants. Music swirled from the truck's speakers, a mishmash of popular Kenyan songs from the turn of the century and Nigerian megahits. The countries we were traveling to had been chosen mostly because they were all English-speaking and provided visa-free travel to Kenyans, so the border crossings were simple, with clearances for the trucks, stamps for our passports and, in Botswana, disinfectant for our shoes.
Talk among the passengers was already turning toward doing similar trips in other parts of Africa. One suggested starting in Namibia, sweeping down along the coast into South Africa, moving through the megacities there, then traveling to Lesotho and Eswatini before entering Mozambique. Another pitched a West Africa trip. It all sounded exciting. Everything was possible. But then another passenger brought up Niger, where a coup had just led to the country's closure of its borders. What would happen if a person took a West Africa road trip and then there was a coup? Would the passenger have to stay there and never go home? We laughed at the absurdity. But behind the laughter was real heartache. Because the reality is that any African traveler has thought about the difficulty of traveling as an African.
My mother was a traveler, and when she traveled for work, my brothers and I would travel in Kenya with her. Then, when I was older, the expanse of my travel grew larger: First I traveled around Kenya, then around East Africa. Now I have a desire to explore the continent, to explore versions of myself in other countries in Africa, home to some of the most humbling and impressive landscapes and vistas in the world: to the largest freestanding mountain on earth (Kilimanjaro); to the largest hot desert in the world (Sahara); to thundering waterfalls twice as wide and deep as Niagara (Victoria); to sparkling white-sand beaches; to UNESCO-listed nature reserves; to cities whose histories stretch back through millennia; and to award-winning wine regions. But I find myself marooned before the bank of difficulties other African travelers face.
A few months after my Green Ranger trip, I spoke to Anneli Douglas, an academic at the University of Pretoria in South Africa who has studied travel in Africa. She pointed out how much easier it is for Western visitors to get visas for Africa than it is for African travelers to visit their countries. "Sometimes, travelers have to travel long distances to apply for a visa, or there might not even be representation of the destination country in the home country, making it difficult to obtain a visa at all," she says. "Also, for Western countries, the cost to obtain a visa to Africa is much cheaper than what it is for Africans-considering the value of the local currency."
In places like Kenya, African destinations are rarely marketed to would-be travelers. Instead, there is a surfeit of packages offering holiday trips in destinations like Dubai, Bangkok, and Istanbul, because it is not only easier but also often cheaper to organize trips to these places than it is to organize trips within the continent. Even when visas are relatively easily attainable, travel from one African country to another is rife with difficulties. Sam Maundu, a Nairobi-based tour operator who runs Rosolo Safaris , which organizes trips around Africa, had no shortage of factors ready when I asked what these difficulties are: "Language barriers, visa restrictions, expensive flights, African destinations not targeting Africans to visit, long distances to be covered either by road or by flight since there are often no direct flights, security situations in some places, perception that there is nothing to see in other African countries, harassment by border officials."
One of the lingering effects of colonialism on the continent is that interaction between African countries tends to exist along mostly colonial lines: There are the former Portuguese colonies, the former British colonies, the former French colonies. Passport holders from Kenya, which was colonized by Britain, are mostly able to go to former British colonies visa-free or with visa-on-arrival status. This means that for a person planning a trip, it becomes easier to think of traveling to these countries. On our multiple-country road trip, the travelers were mostly holders of Kenyan and Ugandan passports (Uganda, another former British colony), and so the countries that the trucks went to were all-except for Namibia-former vestiges of the British Empire. This shared history meant also that because all these countries have English as an official language, it would be relatively easy for us travelers to communicate with people there.
Samuel Agblorti is a lecturer at the Centre for Mixed Migration and Diaspora Studies of the University of Cape Coast in Ghana. I ask him about about a hypothetical trip from Cameroon to Senegal, across a region where multiple coups have happened in recent years. Safety concerns rising from these events had further entrenched visa restrictions across Africa. "Because our borders aren't very well protected, there is a fear that allowing too many visitors will make it unsafe," Agblorti tells me. But even getting those visitors has been a problem.
In 2016, the African Union announced plans for an AU passport to be rolled out by 2020. This passport would open travel across the continent, as more African citizens wouldn't need visas to travel to other African countries. However, more than seven years later, the passport hasn't been launched, stymied by a mixture of security concerns and protectionist attitudes among African states. (The AU remains silent on when and if the passport will be launched.) Still, Agblorti says such a passport would not necessarily be the panacea that its supporters think it would be as it wouldn't automatically lead to visa-free travel without individual states implementing it. He gave the example of regional blocs such as the Economic Community of West African States (ECOWAS), whose membership comprises 15 West African states whose citizens hold ECOWAS passports. "Even within ECOWAS, there are protocols that member countries are supposed to adhere to, but some of them don't," he says. "You may have a common passport, but if the countries don't make extra commitments, then it doesn't matter."
Thus far, only a handful of African countries have committed to allowing African visitors to visit without a visa: Gambia, Benin, and Seychelles; Rwanda has announced plans to implement this. On a small scale, then, African visitors to these countries will experience the promise of the AU passport-if it does indeed come to fruition.
Most recently, in December 2023, rather than introduce the visa-free status its president had promised , Kenya announced that it would require an electronic travel authorization (ETA) , to increase revenue from visitors seeking to enter Kenya. Visa-free entry was scrapped for all but five other East African countries, and new travel requirements and fees were introduced for countries whose citizens had previously enjoyed visa-free travel into Kenya. To some, the doors of entry-rather than being flung open-were being closed even tighter.
Another issue is how expensive it is to travel in Africa. According to a 2013 World Bank report , airfare within Africa is roughly 50 percent more expensive than airfare in comparable locations worldwide. Flights from one African country to the other tend to be much more expensive than flights from Africa to Europe and Asia, despite logic that the shorter the distance, the cheaper the flight ought to be. This means, in effect, that a traveler from Kampala, Uganda, would find it more affordable, and therefore more attractive, to fly to Dubai than to Maputo, Mozambique, despite the latter being much closer than the UAE.
Tour operator Maundu told me that this makes it difficult for him to suggest to his clients travel packages that involve other African destinations: Often, it means the cost of the round-trip air tickets more than doubles the cost of the entire travel package. And there aren't always reliable road or rail options that offer alternative transport to travelers. Most leisure travelers can't move directly by rail from Kenya to South Africa (there is a luxury train network between Tanzania and South Africa that costs $19,000), while in most other regions of the continent, not only are there no multicountry rail options, but also existing bus networks rely on terrible roads.
The irregularity or non-availability of intra-regional air connections and of internal air transport also constrains access to internal destinations and prevents progress with multicountry tourism packages, Maundu says. Also, tax rates per passenger in Africa are more expensive than they are on other continents: The total tax per passenger is about $64, compared to $30.23 in Europe and $29.65 in the Middle East. This is exacerbated by the lack of a single unified aviation market, whose absence means that fares and tax rates swing with volatility across different parts of the continent.
Rather than negotiate with one central body, airlines operating in Africa deal with individual countries, which each usually have different rates and requirements for entry. In Europe, for instance, the establishment of the European Common Aviation Area (ECAA) in 2006 decreased airfares across Europe by making possible the rise of a fleet of low-cost airlines, and at the same time increased the volume of flights within European airports. In this vein, there have been attempts to establish a single aviation market in Africa. The most recent of these attempts is the Single African Air Transport Market (SAATM). Announced in 2018 , the SAATM so far has signed on 34 countries. However, like the AU passport before it, the SAATM has not been implemented, and so it remains nothing but an idea.
In the meantime, African travelers continue to dream. Travel plans continue to be made. Potential destinations continue to be talked about. At the end of our seven-country road trip, as we headed back to Kenya, we spoke again about organizing future trips together, our group of strangers now bonded as friends. Some people discussed taking a trip to Uganda over the next month. Others talked about heading across the Indian Ocean to Mauritius. In Lusaka, Zambia, where the first batch of travelers would leave us to fly back to Nairobi, weepy goodbyes were made. "We are family," one of them said.
IMAGES
COMMENTS
Dubai welcomes everyone with pleasant weather in December; with usual temperatures ranging from 21°C to 27°C and a daily average of 24°C. Many say this is Dubai's best season, as the sun still smiles upon the city, accompanied by cool breezes. Humidity levels are low and the waters lapping against the pristine beaches are still warm enough ...
Dubai Weather in December. If it's the scorching heat of the summer months that has ever put you off visiting Dubai, then get set for the wonderfully mild days of December and the winter months in Dubai.. You'll experience average temperatures in December of around 26°C/78.8°F, and the average sea temperature is around the same, 25.6°C/78°F.
Average temperatures in Dubai in December range from 16°C (61°F) at night to 26°C (79°F) during the day. Rainfall is rare, but there is a slight chance of light showers. ... Dubai is a popular tourist destination, so it's important to choose your travel times carefully to avoid the crowds. The cooler winter months are the ideal time to ...
Sat Dec 9. 8am. Sheikh Zayed Rd, Al Barsha, Al Barsha 1, Dubai.Skidxb.com (600599905). Take part in a snow run at Ski Dubai . Don your winter woollies and Santa hats, it's time to sprint on the snow this December. The coolest (ahem) race in town is back for 2023, the Festive Fun Run at Ski Dubai on Saturday December 9.
Watch the magical freezing adventure with the little ones as they titter and giggle to the performances of Mr Thunder, Mrs Cloud, and the Crazy Little Snowflakes. A proper Christmas show this December in Dubai. From Dhs75. Dec 4 (11am). The Theatre, Mall of the Emirates. malloftheemirates.com (800 663 6255).
11. Walk through stunning light installations. Photo: Dubai Lights Festival. The annual Dubai Lights festival is running until January 14. Gleaming light installations created by talented artists, designers, architects and studios from around the world dot specific destinations in Dubai and feature different themes.
The Weather in Dubai in December. Dubai is famous for its relentless heat and sunshine. Thankfully, December offers respite from the scorching summer, with average daytime temperatures hovering around a comfortable 25-30°C. Evenings can be cooler, so bring a light jacket or sweater for nighttime activities.
5. Enjoy A Desert Safari. Image Source. Desert safari in Dubai is one of the best things to do in Dubai in December. You can visit the vast expanse of the Arabian Desert and participate in different desert activities like sand bashing, sandboarding, quad bikes and the much-desired camel ride.
Accompanied by dazzling fireworks, pop-up events and a host of concerts, the DSF is amongst the grandest shopping festivals in the world. Expo City: Winter City. December 8, 2023 - January 7, 2024. Winter City at Expo City Dubai is the ultimate winter wonderland!
Embrace the charm of December in Dubai, where weather, holidays, and experiences come together to create a memorable travel adventure! Dubai Temperatures in December. Dubai experiences an average temperature of 21 °C (70 °F) in December, with fluctuations ranging between a minimum of 16 °C (61 °F) and a maximum of 26 °C (79 °F). During ...
The weather in December is pleasant, making it ideal for sightseeing and outdoor activities. In December, the temperature in Dubai fluctuates from 26°C to 14°C. Average Temperature: High - 26ºC Low - 14ºC. Average Rainfall: 0.4-1.7 inches (approximately 1 of rain) Daily Wind Speed: 7.9 mph. Temperature of the sea: 23ºC.
As Dubai slips gracefully into a mild winter, December has historically ranged from highs of 28 ° C/82.4 ° F at the start of the month through to 25°C/77°F at the end of December. Dubai's average daytime temperature in December is 26°C/78.8°F. Days are typically clear and sunny but there is a small chance of rain and thunderstorms - 8 ...
In December, the weather in Dubai is perfect because it is the winter season and temperatures range between 15-30 degrees Celsius. This is a stark difference from the summer months when the temperatures are burning around 40-50 degrees Celsius, and the intense heat makes it impossible to plan for most places to visit in Dubai during the day.
The Madinat Jumeirah Festive Market is the home of Christmas in Dubai. Running from 15 th December 2023 to 7 th January 2024 the market is filled with festive fun. Here you can take an Abra ride with Santa, go on a North Pole train and even see snow. Families visiting Dubai in December will particularly love this one.
Tips for finding Dubai package deals. There are loads of types of vacations in Dubai and the cost will depend on what type of trip you're taking and for how long you'd like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $666; Family vacation $593; Romantic vacation $805; Luxury vacation $759; Budget ...
Shop for essentials. While you can get almost everything in Dubai, don't forget your sunscreen, preferred toiletries and medication for convenience. If you're travelling only with hand baggage, make sure any liquids, aerosols and gels are 100ml or less, and that all fit into a small transparent plastic bag. Finalise your holiday wardrobe.
Average December maximum temperatures in December can be up to 28C (82F) In the hottest months, July, August, and September, temperatures in Dubai can hit 50C (122F), so December is much more pleasant temperature-wise. Humidity rises through December, so by the end of December temperatures may actually feel hotter.
Book today and enjoy guaranteed savings, low deposits from $199pp, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Simply view our dubai vacation offers below or call our destination specialists on 1-855-358-1505 for further details and to book. 30% saving on stay. Book now.
December is one of the driest months in Dubai, with an average rainfall of just about 10 millimetres, ensuring rain won't disrupt your plans. The city basks in an abundance of sunshine, boasting an average of 8 to 9 hours of daylight per day. This weather combination makes December an ideal time to visit Dubai, providing a wonderful ...
Before you visit Dubai, we recommend that you review the 14-day weather forecast for Dubai. A moderate high of 25.3°C (77.5°F) is recorded in December in Dubai, while the average low is 20.9°C (69.6°F) in December. There is 56% of relative humidity on average in Dubai during the month of December. During December Dubai sees 4mm of ...
5 nights from £1,929pp. Half Board. Deluxe Room Ocean with Balcony. Unlimited access to Wild Wadi Waterpark. Travel on selected dates from 24 to 30 October 2024. Return Emirates flights from Manchester. Price based on 2 adults and 2 children.
DAY 3 - December 18 - FREE Day. Enjoy a day of shopping, take a tour of the city, visit a museum, or take advantage of the gorgeous weather by relaxing and having a beach day. DAY 4 - December 19 - Today, will enjoy Dubai's skyline from the comfort of a private yacht. We will cruise and relax as we sail along the marina and Arabian ...
Dubai holiday deals customized by the travel experts at Flight Centre. Book now for the adventure of a lifetime! Help. Help Manage booking. Flights Holidays Cars Tours Cruises Deals More. Flights Holidays Cars Tours Cruises Deals More. Get a Quote Stores. 0877 40 50 00. Dubai Holiday Deals. Holidays. Holidays. Dubai.
When are the UAE public holidays 2025? January 1 2025: New Year's Day. Ramadan 30: If Ramadan is a 30-day month. Shawwal 1: Eid Al Fitr holiday. Shawwal 2: Eid Al Fitr holiday. Shawwal 3: Eid Al Fitr holiday. Dhu Al Hijjah 9: Arafat Day. Dhu Al Hijjah 10: Eid Al Adha.
Travellers based outside of the UAE who are travelling to Dubai, can get access to The View at The Palm, AYA Universe, Dubai Parks & Resorts and Wild Wadi Waterpark. This fantastic offer runs from 22 May 2024 to 11 June 2024 and valid for travel between 25 May 2024 to 31 August 2024.
Powered by. By Saifur Rahman Investment Corporation of Dubai, an investment arm of the Government of Dubai, reported a 68 percent jump in net profits to a new record of Dh60.8 billion on Dh310.2 billion in revenue for the year ended 31 December 2023. This growth has been backed with strong growth reported by the Emirates Group.
The UAE public holidays calendar also includes Rabi Al Awwal 12, which marks the Prophet Mohammed's (PBUH) birthday, and December 2 and 3, 2025 as the 54th UAE National Day holiday.
Most recently, in December 2023, rather than introduce the visa-free status its president had promised, Kenya announced that it would require an electronic travel authorization (ETA), to increase ...